PDB entry 1yz4

View 1yz4 on RCSB PDB site
Description: Crystal structure of DUSP15
Class: hydrolase
Keywords: hydrolase
Deposited on 2005-02-28, released 2005-11-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.217
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: dual specificity phosphatase-like 15 isoform a
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5QP65 (3-End)
      • cloning artifact (0-2)
      • engineered (90)
    Domains in SCOPe 2.07: d1yz4a1, d1yz4a2
  • Chain 'B':
    Compound: dual specificity phosphatase-like 15 isoform a
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5QP65 (Start-159)
      • engineered (90)
    Domains in SCOPe 2.07: d1yz4b_
  • Heterogens: BOG, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1yz4A (A:)
    gshmgngmtkvlpglylgnfidakdldqlgrnkithiisihespqpllqditylripvad
    tpevpikkhfkecinfihccrlnggnclvhsfagisrsttivtayvmtvtglgwrdvlea
    ikatrpianpnpgfrqqleefgwassqklrrqleerfges
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yz4A (A:)
    gshmgngmtkvlpglylgnfidakdldqlgrnkithiisihespqpllqditylripvad
    tpevpikkhfkecinfihccrlnggnclvhsfagisrsttivtayvmtvtglgwrdvlea
    ikatrpianpnpgfrqqleefgwassqklrrqleerfge
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1yz4B (B:)
    gshmgngmtkvlpglylgnfidakdldqlgrnkithiisihespqpllqditylripvad
    tpevpikkhfkecinfihccrlnggnclvhsfagisrsttivtayvmtvtglgwrdvlea
    ikatrpianpnpgfrqqleefgwassqklrrqleerfges
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yz4B (B:)
    gngmtkvlpglylgnfidakdldqlgrnkithiisihespqpllqditylripvadtpev
    pikkhfkecinfihccrlnggnclvhsfagisrsttivtayvmtvtglgwrdvleaikat
    rpianpnpgfrqqleefgwassqklrrqleerfges