PDB entry 1yz1

View 1yz1 on RCSB PDB site
Description: Crystal structure of human translationally controlled tumour associated protein
Class: unknown function
Keywords: tumor protein, UNKNOWN FUNCTION
Deposited on 2005-02-26, released 2006-05-16
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-02-07, with a file datestamp of 2018-02-02.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: translationally controlled tumor protein
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P13693 (2-173)
      • cloning artifact (0-1)
    Domains in SCOPe 2.08: d1yz1a2, d1yz1a3
  • Chain 'B':
    Compound: translationally controlled tumor protein
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P13693 (2-173)
      • cloning artifact (0-1)
    Domains in SCOPe 2.08: d1yz1b2, d1yz1b3
  • Chain 'C':
    Compound: translationally controlled tumor protein
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P13693 (2-173)
      • cloning artifact (0-1)
    Domains in SCOPe 2.08: d1yz1c2, d1yz1c3
  • Chain 'D':
    Compound: translationally controlled tumor protein
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P13693 (2-173)
      • cloning artifact (0-1)
    Domains in SCOPe 2.08: d1yz1d2, d1yz1d3
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1yz1A (A:)
    efmiiyrdlishdemfsdiykireiadglclevegkmvsrtegniddsliggnasaegpe
    gegtestvitgvdivmnhhlqetsftkeaykkyikdymksikgkleeqrpervkpfmtga
    aeqikhilanfknyqffigenmnpdgmvalldyredgvtpymiffkdglemekc
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yz1A (A:)
    efmiiyrdlishdemfsdiykireiadglclevegkmvsritgvdivmnhhlqetsftke
    aykkyikdymksikgkleeqrpervkpfmtgaaeqikhilanfknyqffigenmnpdgmv
    alldyredgvtpymiffkdglemekc
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1yz1B (B:)
    efmiiyrdlishdemfsdiykireiadglclevegkmvsrtegniddsliggnasaegpe
    gegtestvitgvdivmnhhlqetsftkeaykkyikdymksikgkleeqrpervkpfmtga
    aeqikhilanfknyqffigenmnpdgmvalldyredgvtpymiffkdglemekc
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yz1B (B:)
    efmiiyrdlishdemfsdiykireiadglclevegkmvsrtgvdivmnhhlqetsftkea
    ykkyikdymksikgkleeqrpervkpfmtgaaeqikhilanfknyqffigenmnpdgmva
    lldyredgvtpymiffkdglemekc
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1yz1C (C:)
    efmiiyrdlishdemfsdiykireiadglclevegkmvsrtegniddsliggnasaegpe
    gegtestvitgvdivmnhhlqetsftkeaykkyikdymksikgkleeqrpervkpfmtga
    aeqikhilanfknyqffigenmnpdgmvalldyredgvtpymiffkdglemekc
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yz1C (C:)
    efmiiyrdlishdemfsdiykireiadglclevegkmvsitgvdivmnhhlqetsftkea
    ykkyikdymksikgkleeqrpervkpfmtgaaeqikhilanfknyqffigenmnpdgmva
    lldyredgvtpymiffkdglemekc
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1yz1D (D:)
    efmiiyrdlishdemfsdiykireiadglclevegkmvsrtegniddsliggnasaegpe
    gegtestvitgvdivmnhhlqetsftkeaykkyikdymksikgkleeqrpervkpfmtga
    aeqikhilanfknyqffigenmnpdgmvalldyredgvtpymiffkdglemekc
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yz1D (D:)
    efmiiyrdlishdemfsdiykireiadglclevegkmvsrgvdivmnhhlqetsftkeay
    kkyikdymksikgkleeqrpervkpfmtgaaeqikhilanfknyqffigenmnpdgmval
    ldyredgvtpymiffkdglemekc