PDB entry 1yyz

View 1yyz on RCSB PDB site
Description: R-State AMP Complex Reveals Initial Steps of the Quaternary Transition of Fructose-1,6-bisphosphatase
Class: hydrolase
Keywords: Allostearic enzymes, Intermediate states, Fructose-1, 6-bisphosphatase, FBPase, glycolysis, gluconeogenesis, HYDROLASE
Deposited on 2005-02-25, released 2005-03-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: N/A
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: fructose-1,6-bisphosphatase
    Species: Sus scrofa [TaxId:9823]
    Gene: FBP1, FBP
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00636
      • engineered (53)
    Domains in SCOPe 2.07: d1yyza_
  • Heterogens: F6P, PO4, MG, AMP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1yyzA (A:)
    tdqaafdtnivtltrfvmeegrkargtgemtqllnslctavkaistavrkagilhlygia
    gstnvtgdqvkkldvlsndlvinvlkssfatcvlvseedknaiivepekrgkyvvcfdpl
    dgssnidclvsigtifgiyrknstdepsekdalqpgrnlvaagyalygsatmlvlamvng
    vncfmldpaigefilvdrdvkikkkgsiysinegyakefdpaiteyiqrkkfppdnsapy
    garyvgsmvadvhrtlvyggifmypankkspkgklrllyecnpmayvmekagglattgke
    avldivptdihqrapiilgspedvtelleiyqkhaak
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yyzA (A:)
    ivtltrfvmeegrkargtgemtqllnslctavkaistavrkagilhlygiagstnvtgdq
    vkkldvlsndlvinvlkssfatcvlvseedknaiivepekrgkyvvcfdpldgssnidcl
    vsigtifgiyrknstdepsekdalqpgrnlvaagyalygsatmlvlamvngvncfmldpa
    igefilvdrdvkikkkgsiysinegyakefdpaiteyiqrkkfppdnsapygaryvgsmv
    advhrtlvyggifmypankkspkgklrllyecnpmayvmekagglattgkeavldivptd
    ihqrapiilgspedvtelleiyqkha