PDB entry 1yyy

View 1yyy on RCSB PDB site
Description: Trypsin inhibitors with rigid tripeptidyl aldehydes
Class: hydrolase/hydrolase inhibitor
Keywords: SERINE PROTEASE, HYDROLASE-HYDROLASE INHIBITOR complex
Deposited on 1998-06-03, released 1999-06-08
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.157
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain '1':
    Compound: Trypsin
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1yyy1_
  • Heterogens: CA, 0KV, HOH

PDB Chain Sequences:

  • Chain '1':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1yyy1 (1:)
    ivggytcgantvpyqvslnsgyhfcggslinsqwvvsaahcyksgiqvrlgedninvveg
    neqfisasksivhpsynsntlnndimliklksaaslnsrvasislptscasagtqclisg
    wgntkssgtsypdvlkclkapilsdsscksaypgqitsnmfcagyleggkdscqgdsggp
    vvcsgklqgivswgsgcaqknkpgvytkvcnyvswikqtiasn