PDB entry 1yyy

View 1yyy on RCSB PDB site
Description: Trypsin inhibitors with rigid tripeptidyl aldehydes
Deposited on 1998-06-03, released 1999-06-08
The last revision prior to the SCOP 1.71 freeze date was dated 1999-06-08, with a file datestamp of 1999-06-07.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.157
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain '1':
    Domains in SCOP 1.71: d1yyy1_

PDB Chain Sequences:

  • Chain '1':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1yyy1 (1:)
ivggytcgantvpyqvslnsgyhfcggslinsqwvvsaahcyksgiqvrlgedninvveg
neqfisasksivhpsynsntlnndimliklksaaslnsrvasislptscasagtqclisg
wgntkssgtsypdvlkclkapilsdsscksaypgqitsnmfcagyleggkdscqgdsggp
vvcsgklqgivswgsgcaqknkpgvytkvcnyvswikqtiasn