PDB entry 1yyx

View 1yyx on RCSB PDB site
Description: The solution structure of a redesigned apocytochrome B562 (Rd-apocyt b562) at 2.8M urea
Deposited on 2005-02-25, released 2005-08-25
The last revision was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Redesigned apo-cytochrome b562
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 1YYX (0-105)

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >1yyxA (A:)
    adlednwetlndnlkviekadnaaqvkdaltkmraaaldaqkatppkledkspdspemkd
    frhgfdilvgqiddalklanegkvkeaqaaaeqlkttiraynqkyg