PDB entry 1yyw

View 1yyw on RCSB PDB site
Description: Crystal structure of RNase III from Aquifex aeolicus complexed with double stranded RNA at 2.8-Angstrom Resolution
Class: hydrolase/RNA
Keywords: Ribonuclease III, double-stranded RNA, RNA interference, endonucleolytic cleavage
Deposited on 2005-02-25, released 2005-11-22
The last revision prior to the SCOP 1.73 freeze date was dated 2005-11-22, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.243
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ribonuclease III
    Species: Aquifex aeolicus
    Gene: rnc
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1yywa1, d1yywa2
  • Chain 'B':
    Compound: Ribonuclease III
    Species: Aquifex aeolicus
    Gene: rnc
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1yywb1, d1yywb2
  • Chain 'C':
    Compound: Ribonuclease III
    Species: Aquifex aeolicus
    Gene: rnc
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1yywc1, d1yywc2
  • Chain 'D':
    Compound: Ribonuclease III
    Species: Aquifex aeolicus
    Gene: rnc
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1yywd1, d1yywd2
  • Chain 'E':
    Compound: 5'-r(*ap*ap*ap*up*ap*up*ap*up*ap*up*up*u)-3'
  • Chain 'F':
    Compound: 5'-r(*ap*ap*ap*up*ap*up*ap*up*ap*up*up*u)-3'
  • Chain 'G':
    Compound: 5'-r(*ap*ap*ap*up*ap*up*ap*up*ap*up*up*u)-3'
  • Chain 'H':
    Compound: 5'-r(*ap*ap*ap*up*ap*up*ap*up*ap*up*up*u)-3'
  • Chain 'I':
    Compound: 5'-r(*ap*ap*ap*up*ap*up*ap*up*ap*up*up*u)-3'
  • Chain 'J':
    Compound: 5'-r(*ap*ap*ap*up*ap*up*ap*up*ap*up*up*u)-3'
  • Chain 'K':
    Compound: 5'-r(*ap*ap*ap*up*ap*up*ap*up*ap*up*up*u)-3'
  • Chain 'L':
    Compound: 5'-r(*ap*ap*ap*up*ap*up*ap*up*ap*up*up*u)-3'
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1yywA (A:)
    mkmleqlekklgytfkdksllekalthvsyskkehyetleflgdalvnffivdllvqysp
    nkregflsplkayliseeffnllaqklelhkfirikrgkinetiigdvfealwaavyids
    grdanftrelfyklfkedilsaikegrvkkdyktilqeitqkrwkerpeyrlisvegphh
    kkkfiveakikeyrtlgegkskkeaeqraaeeliklleese
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yywA (A:)
    kmleqlekklgytfkdksllekalthvsyskkehyetleflgdalvnffivdllvqyspn
    kregflsplkayliseeffnllaqklelhkfirikrgkinetiigdvfealwaavyidsg
    rdanftrelfyklfkedilsaikegrvkkdyktilqeitqkrwkerpeyrlisvegphhk
    kkfiveakikeyrtlgegkskkeaeqraaeelikllees
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1yywB (B:)
    mkmleqlekklgytfkdksllekalthvsyskkehyetleflgdalvnffivdllvqysp
    nkregflsplkayliseeffnllaqklelhkfirikrgkinetiigdvfealwaavyids
    grdanftrelfyklfkedilsaikegrvkkdyktilqeitqkrwkerpeyrlisvegphh
    kkkfiveakikeyrtlgegkskkeaeqraaeeliklleese
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yywB (B:)
    kmleqlekklgytfkdksllekalthvsyskkehyetleflgdalvnffivdllvqyspn
    kregflsplkayliseeffnllaqklelhkfirikrgkinetiigdvfealwaavyidsg
    rdanftrelfyklfkedilsaikegrvkkdyktilqeitqkrwkerpeyrlisvegphhk
    kkfiveakikeyrtlgegkskkeaeqraaeelikllees
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1yywC (C:)
    mkmleqlekklgytfkdksllekalthvsyskkehyetleflgdalvnffivdllvqysp
    nkregflsplkayliseeffnllaqklelhkfirikrgkinetiigdvfealwaavyids
    grdanftrelfyklfkedilsaikegrvkkdyktilqeitqkrwkerpeyrlisvegphh
    kkkfiveakikeyrtlgegkskkeaeqraaeeliklleese
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yywC (C:)
    kmleqlekklgytfkdksllekalthvsyskkehyetleflgdalvnffivdllvqyspn
    kregflsplkayliseeffnllaqklelhkfirikrgkinetiigdvfealwaavyidsg
    rdanftrelfyklfkedilsaikegrvkkdyktilqeitqkrwkerpeyrlisvegphhk
    kkfiveakikeyrtlgegkskkeaeqraaeelikllee
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1yywD (D:)
    mkmleqlekklgytfkdksllekalthvsyskkehyetleflgdalvnffivdllvqysp
    nkregflsplkayliseeffnllaqklelhkfirikrgkinetiigdvfealwaavyids
    grdanftrelfyklfkedilsaikegrvkkdyktilqeitqkrwkerpeyrlisvegphh
    kkkfiveakikeyrtlgegkskkeaeqraaeeliklleese
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yywD (D:)
    kmleqlekklgytfkdksllekalthvsyskkehyetleflgdalvnffivdllvqyspn
    kregflsplkayliseeffnllaqklelhkfirikrgkinetiigdvfealwaavyidsg
    rdanftrelfyklfkedilsaikegrvkkdyktilqeitqkrwkerpeyrlisvegphhk
    kkfiveakikeyrtlgegkskkeaeqraaeelikllees
    

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    No sequence available.

  • Chain 'G':
    No sequence available.

  • Chain 'H':
    No sequence available.

  • Chain 'I':
    No sequence available.

  • Chain 'J':
    No sequence available.

  • Chain 'K':
    No sequence available.

  • Chain 'L':
    No sequence available.