PDB entry 1yyv

View 1yyv on RCSB PDB site
Description: Putative transcriptional regulator ytfH from Salmonella typhimurium
Class: structural genomics, unknown function
Keywords: putative transcriptional regulator, reductive methylation, dimethyl lysine, Structural Genomics, PSI, Protein Structure Initiative, Midwest Center for Structural Genomics, MCSG, UNKNOWN FUNCTION
Deposited on 2005-02-25, released 2005-04-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.35 Å
R-factor: 0.2
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Putative transcriptional regulator
    Species: SALMONELLA TYPHIMURIUM [TaxId:99287]
    Gene: ytfH
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q7CP90
      • modified residue (56-57)
      • modified residue (63-64)
      • modified residue (104)
    Domains in SCOPe 2.07: d1yyva1
  • Chain 'B':
    Compound: Putative transcriptional regulator
    Species: SALMONELLA TYPHIMURIUM [TaxId:99287]
    Gene: ytfH
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q7CP90
      • modified residue (56-57)
      • modified residue (63-64)
      • modified residue (104)
    Domains in SCOPe 2.07: d1yyvb_
  • Heterogens: CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1yyvA (A:)
    snamrahtlsrqlregnlfaeqcpsrevlkhvtsrwgvlilvalrdgthrfsdlrrkmgg
    vsekmlaqslqaleqdgflnrvsypvvpphveysltplgeqvsdkvaaladwielnlpqv
    laqrerlsdgg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yyvA (A:)
    qlregnlfaeqcpsrevlkhvtsrwgvlilvalrdgthrfsdlrrkmggvsekmlaqslq
    aleqdgflnrvsypvvpphveysltplgeqvsdkvaaladwielnlpqvlaqre
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1yyvB (B:)
    snamrahtlsrqlregnlfaeqcpsrevlkhvtsrwgvlilvalrdgthrfsdlrrkmgg
    vsekmlaqslqaleqdgflnrvsypvvpphveysltplgeqvsdkvaaladwielnlpqv
    laqrerlsdgg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yyvB (B:)
    egnlfaeqcpsrevlkhvtsrwgvlilvalrdgthrfsdlrrkmggvsekmlaqslqale
    qdgflnrvsypvvpphveysltplgeqvsdkvaaladwielnlpqvlaqrer