PDB entry 1yyu

View 1yyu on RCSB PDB site
Description: D100E Trichodiene Synthase: Complex With Mg, Pyrophosphate, and (4S)-7-azabisabolene
Class: lyase
Keywords: terpenoid cyclase fold, site-directed mutant, Pyrophosphate, (4S)-7-azabisabolene, LYASE
Deposited on 2005-02-25, released 2005-03-29
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.95 Å
R-factor: 0.218
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: trichodiene synthase
    Species: Fusarium sporotrichioides [TaxId:5514]
    Gene: TRI5
    Database cross-references and differences (RAF-indexed):
    • Uniprot P13513 (0-End)
      • engineered (99)
    Domains in SCOPe 2.08: d1yyua_
  • Chain 'B':
    Compound: trichodiene synthase
    Species: Fusarium sporotrichioides [TaxId:5514]
    Gene: TRI5
    Database cross-references and differences (RAF-indexed):
    • Uniprot P13513 (0-End)
      • engineered (99)
    Domains in SCOPe 2.08: d1yyub_
  • Heterogens: MG, RAZ, SAZ, POP, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1yyuA (A:)
    menfpteyflnttvrlleyiryrdsnytreerienlhyaynkaahhfaqprqqqllkvdp
    krlqaslqtivgmvvyswakvskecmadlsihytytlvledskddpyptmvnyfddlqag
    reqahpwwalvnehfpnvlrhfgpfcslnlirstldffegcwieqynfggfpgshdypqf
    lrrmnglghcvgaslwpkeqfnerslfleitsaiaqmenwmvwvndlmsfykefdderdq
    islvknyvvsdeislhealekltqdtlhsskqmvavfsdkdpqvmdtiecfmhgyvtwhl
    cdrryrlseiyekvkeektedaqkfckfyeqaanvgavspsewayppvaqlanvrskdvk
    evqkpflssielve
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yyuA (A:)
    menfpteyflnttvrlleyiryrdsnytreerienlhyaynkaahhfaqprqqqllkvdp
    krlqaslqtivgmvvyswakvskecmadlsihytytlvledskddpyptmvnyfddlqag
    reqahpwwalvnehfpnvlrhfgpfcslnlirstldffegcwieqynfggfpgshdypqf
    lrrmnglghcvgaslwpkeqfnerslfleitsaiaqmenwmvwvndlmsfykefdderdq
    islvknyvvsdeislhealekltqdtlhsskqmvavfsdkdpqvmdtiecfmhgyvtwhl
    cdrryrlseiyekvkeektedaqkfckfyeqaanvgavspsewayppvaqlanv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1yyuB (B:)
    menfpteyflnttvrlleyiryrdsnytreerienlhyaynkaahhfaqprqqqllkvdp
    krlqaslqtivgmvvyswakvskecmadlsihytytlvledskddpyptmvnyfddlqag
    reqahpwwalvnehfpnvlrhfgpfcslnlirstldffegcwieqynfggfpgshdypqf
    lrrmnglghcvgaslwpkeqfnerslfleitsaiaqmenwmvwvndlmsfykefdderdq
    islvknyvvsdeislhealekltqdtlhsskqmvavfsdkdpqvmdtiecfmhgyvtwhl
    cdrryrlseiyekvkeektedaqkfckfyeqaanvgavspsewayppvaqlanvrskdvk
    evqkpflssielve
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yyuB (B:)
    menfpteyflnttvrlleyiryrdsnytreerienlhyaynkaahhfaqprqqqllkvdp
    krlqaslqtivgmvvyswakvskecmadlsihytytlvledskddpyptmvnyfddlqag
    reqahpwwalvnehfpnvlrhfgpfcslnlirstldffegcwieqynfggfpgshdypqf
    lrrmnglghcvgaslwpkeqfnerslfleitsaiaqmenwmvwvndlmsfykefdderdq
    islvknyvvsdeislhealekltqdtlhsskqmvavfsdkdpqvmdtiecfmhgyvtwhl
    cdrryrlseiyekvkeektedaqkfckfyeqaanvgavspsewayppvaqlanv