PDB entry 1yyt

View 1yyt on RCSB PDB site
Description: D100E Trichodiene Synthase: Complex With Mg, Pyrophosphate, and (4R)-7-azabisabolene
Class: lyase
Keywords: terpenoid cyclase fold, site-directed mutant, Pyrophosphate, (4R)-7-azabisabolene
Deposited on 2005-02-25, released 2005-03-29
The last revision prior to the SCOP 1.73 freeze date was dated 2005-05-03, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.225
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: trichodiene synthase
    Species: Fusarium sporotrichioides
    Gene: TRI5
    Database cross-references and differences (RAF-indexed):
    • Uniprot P13513 (0-End)
      • engineered (99)
    Domains in SCOP 1.73: d1yyta1
  • Chain 'B':
    Compound: trichodiene synthase
    Species: Fusarium sporotrichioides
    Gene: TRI5
    Database cross-references and differences (RAF-indexed):
    • Uniprot P13513 (0-End)
      • engineered (99)
    Domains in SCOP 1.73: d1yytb1
  • Heterogens: MG, POP, SAZ, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1yytA (A:)
    menfpteyflnttvrlleyiryrdsnytreerienlhyaynkaahhfaqprqqqllkvdp
    krlqaslqtivgmvvyswakvskecmadlsihytytlvledskddpyptmvnyfddlqag
    reqahpwwalvnehfpnvlrhfgpfcslnlirstldffegcwieqynfggfpgshdypqf
    lrrmnglghcvgaslwpkeqfnerslfleitsaiaqmenwmvwvndlmsfykefdderdq
    islvknyvvsdeislhealekltqdtlhsskqmvavfsdkdpqvmdtiecfmhgyvtwhl
    cdrryrlseiyekvkeektedaqkfckfyeqaanvgavspsewayppvaqlanvrskdvk
    evqkpflssielve
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yytA (A:)
    menfpteyflnttvrlleyiryrdsnytreerienlhyaynkaahhfaqprqqqllkvdp
    krlqaslqtivgmvvyswakvskecmadlsihytytlvledskddpyptmvnyfddlqag
    reqahpwwalvnehfpnvlrhfgpfcslnlirstldffegcwieqynfggfpgshdypqf
    lrrmnglghcvgaslwpkeqfnerslfleitsaiaqmenwmvwvndlmsfykefdderdq
    islvknyvvsdeislhealekltqdtlhsskqmvavfsdkdpqvmdtiecfmhgyvtwhl
    cdrryrlseiyekvkeektedaqkfckfyeqaanvgavspsewayppvaqlanv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1yytB (B:)
    menfpteyflnttvrlleyiryrdsnytreerienlhyaynkaahhfaqprqqqllkvdp
    krlqaslqtivgmvvyswakvskecmadlsihytytlvledskddpyptmvnyfddlqag
    reqahpwwalvnehfpnvlrhfgpfcslnlirstldffegcwieqynfggfpgshdypqf
    lrrmnglghcvgaslwpkeqfnerslfleitsaiaqmenwmvwvndlmsfykefdderdq
    islvknyvvsdeislhealekltqdtlhsskqmvavfsdkdpqvmdtiecfmhgyvtwhl
    cdrryrlseiyekvkeektedaqkfckfyeqaanvgavspsewayppvaqlanvrskdvk
    evqkpflssielve
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yytB (B:)
    menfpteyflnttvrlleyiryrdsnytreerienlhyaynkaahhfaqprqqqllkvdp
    krlqaslqtivgmvvyswakvskecmadlsihytytlvledskddpyptmvnyfddlqag
    reqahpwwalvnehfpnvlrhfgpfcslnlirstldffegcwieqynfggfpgshdypqf
    lrrmnglghcvgaslwpkeqfnerslfleitsaiaqmenwmvwvndlmsfykefdderdq
    islvknyvvsdeislhealekltqdtlhsskqmvavfsdkdpqvmdtiecfmhgyvtwhl
    cdrryrlseiyekvkeektedaqkfckfyeqaanvgavspsewayppvaqlanv