PDB entry 1yyq

View 1yyq on RCSB PDB site
Description: Y305F Trichodiene Synthase complexed with pyrophosphate
Class: lyase
Keywords: terpenoid cyclase fold, site-directed mutant, Pyrophosphate, LYASE
Deposited on 2005-02-25, released 2005-03-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.239
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: trichodiene synthase
    Species: Fusarium sporotrichioides [TaxId:5514]
    Gene: TRI5
    Database cross-references and differences (RAF-indexed):
    • Uniprot P13513
      • engineered (304)
    Domains in SCOPe 2.07: d1yyqa_
  • Chain 'B':
    Compound: trichodiene synthase
    Species: Fusarium sporotrichioides [TaxId:5514]
    Gene: TRI5
    Database cross-references and differences (RAF-indexed):
    • Uniprot P13513
      • engineered (304)
    Domains in SCOPe 2.07: d1yyqb_
  • Heterogens: MG, POP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1yyqA (A:)
    menfpteyflnttvrlleyiryrdsnytreerienlhyaynkaahhfaqprqqqllkvdp
    krlqaslqtivgmvvyswakvskecmadlsihytytlvlddskddpyptmvnyfddlqag
    reqahpwwalvnehfpnvlrhfgpfcslnlirstldffegcwieqynfggfpgshdypqf
    lrrmnglghcvgaslwpkeqfnerslfleitsaiaqmenwmvwvndlmsfykefdderdq
    islvknyvvsdeislhealekltqdtlhsskqmvavfsdkdpqvmdtiecfmhgyvtwhl
    cdrrfrlseiyekvkeektedaqkfckfyeqaanvgavspsewayppvaqlanvrskdvk
    evqkpflssielve
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yyqA (A:)
    enfpteyflnttvrlleyiryrdsnytreerienlhyaynkaahhfaqprqqqllkvdpk
    rlqaslqtivgmvvyswakvskecmadlsihytytlvlddskddpyptmvnyfddlqagr
    eqahpwwalvnehfpnvlrhfgpfcslnlirstldffegcwieqynfggfpgshdypqfl
    rrmnglghcvgaslwpkeqfnerslfleitsaiaqmenwmvwvndlmsfykefdderdqi
    slvknyvvsdeislhealekltqdtlhsskqmvavfsdkdpqvmdtiecfmhgyvtwhlc
    drrfrlseiyekvkeektedaqkfckfyeqaanvgavspsewayppvaqlanv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1yyqB (B:)
    menfpteyflnttvrlleyiryrdsnytreerienlhyaynkaahhfaqprqqqllkvdp
    krlqaslqtivgmvvyswakvskecmadlsihytytlvlddskddpyptmvnyfddlqag
    reqahpwwalvnehfpnvlrhfgpfcslnlirstldffegcwieqynfggfpgshdypqf
    lrrmnglghcvgaslwpkeqfnerslfleitsaiaqmenwmvwvndlmsfykefdderdq
    islvknyvvsdeislhealekltqdtlhsskqmvavfsdkdpqvmdtiecfmhgyvtwhl
    cdrrfrlseiyekvkeektedaqkfckfyeqaanvgavspsewayppvaqlanvrskdvk
    evqkpflssielve
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yyqB (B:)
    fpteyflnttvrlleyiryrdsnytreerienlhyaynkaahhfaqprqqqllkvdpkrl
    qaslqtivgmvvyswakvskecmadlsihytytlvlddskddpyptmvnyfddlqagreq
    ahpwwalvnehfpnvlrhfgpfcslnlirstldffegcwieqynfggfpgshdypqflrr
    mnglghcvgaslwpkeqfnerslfleitsaiaqmenwmvwvndlmsfykefdderdqisl
    vknyvvsdeislhealekltqdtlhsskqmvavfsdkdpqvmdtiecfmhgyvtwhlcdr
    rfrlseiyekvkeektedaqkfckfyeqaanvgavspsewayppvaqlanv