PDB entry 1yyp

View 1yyp on RCSB PDB site
Description: Crystal structure of cytomegalovirus UL44 bound to C-terminal peptide from CMV UL54
Class: replication/transferase
Keywords: processivity fold (same fold as hsv ul42, pcna, and homotrimeric sliding clamps), replication-transferase complex
Deposited on 2005-02-25, released 2005-12-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA polymerase processivity factor
    Species: Human herpesvirus 5 [TaxId:10359]
    Gene: UL44
    Database cross-references and differences (RAF-indexed):
    • Uniprot P16790
      • see remark 999 (204)
    Domains in SCOPe 2.07: d1yypa1, d1yypa2
  • Chain 'B':
    Compound: DNA polymerase
    Database cross-references and differences (RAF-indexed):
  • Heterogens: SO4, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1yypA (A:)
    mdrktrlsepptlalrlkpyktaiqqlrsviralkenttvtflptpslilqtvrshcvsk
    itfnssclyitdksfqpktinnstpllgnfmyltsskdltkfyvqdisdlsakismcapd
    fnmefssacvhgqdivresensavhvdldfgvvadllkwigphtrvkrnvkkapcptgtv
    qilvhagppaikfiltngseleftsnnrvsfhgvknmrinvqlknfyqtllncavtklpc
    tlrivtehdtllyvasrnglfavenflteepfqrgdpfdknyvgnsgksr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yypA (A:)
    epptlalrlkpyktaiqqlrsviralkenttvtflptpslilqtvrshcvskitfnsscl
    yitdksfqpktinnstpllgnfmyltsskdltkfyvqdisdlsakismcapdfnmefssa
    cvhgqdivresensavhvdldfgvvadllkwigptgtvqilvhagppaikfiltngsele
    ftsnnrvsfhgvknmrinvqlknfyqtllncavtklpctlrivtehdtllyvasrnglfa
    venflteep
    

  • Chain 'B':
    No sequence available.