PDB entry 1yyo

View 1yyo on RCSB PDB site
Description: Crystal structure of RNase III mutant E110K from Aquifex aeolicus complexed with double-stranded RNA at 2.9-Angstrom Resolution
Class: hydrolase/RNA
Keywords: Ribonuclease III, double-stranded RNA, RNA interference, endonucleolytic cleavage, HYDROLASE/RNA COMPLEX
Deposited on 2005-02-25, released 2005-11-22
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.223
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ribonuclease III
    Species: Aquifex aeolicus [TaxId:63363]
    Gene: rnc
    Database cross-references and differences (RAF-indexed):
    • Uniprot O67082 (0-End)
      • engineered (109)
    Domains in SCOPe 2.05: d1yyoa1, d1yyoa2
  • Chain 'B':
    Compound: Ribonuclease III
    Species: Aquifex aeolicus [TaxId:63363]
    Gene: rnc
    Database cross-references and differences (RAF-indexed):
    • Uniprot O67082
      • engineered (109)
    Domains in SCOPe 2.05: d1yyob1, d1yyob2
  • Chain 'C':
    Compound: 5'-r(*cp*gp*cp*gp*ap*ap*up*up*cp*gp*cp*g)-3'
  • Chain 'D':
    Compound: 5'-r(*cp*gp*cp*gp*ap*ap*up*up*cp*gp*cp*g)-3'
  • Chain 'E':
    Compound: 5'-r(*cp*gp*cp*gp*ap*ap*up*up*cp*gp*cp*g)-3'
  • Chain 'F':
    Compound: 5'-r(*cp*gp*cp*gp*ap*ap*up*up*cp*gp*cp*g)-3'
  • Heterogens: TRS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1yyoA (A:)
    mkmleqlekklgytfkdksllekalthvsyskkehyetleflgdalvnffivdllvqysp
    nkregflsplkayliseeffnllaqklelhkfirikrgkinetiigdvfkalwaavyids
    grdanftrelfyklfkedilsaikegrvkkdyktilqeitqkrwkerpeyrlisvegphh
    kkkfiveakikeyrtlgegkskkeaeqraaeeliklleese
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yyoA (A:)
    mkmleqlekklgytfkdksllekalthvsyskkehyetleflgdalvnffivdllvqysp
    nkregflsplkayliseeffnllaqklelhkfirikrgkinetiigdvfkalwaavyids
    grdanftrelfyklfkedilsaikegrvkkdyktilqeitqkrwkerpeyrlisvegphh
    kkkfiveakikeyrtlgegkskkeaeqraaeelikllees
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1yyoB (B:)
    mkmleqlekklgytfkdksllekalthvsyskkehyetleflgdalvnffivdllvqysp
    nkregflsplkayliseeffnllaqklelhkfirikrgkinetiigdvfkalwaavyids
    grdanftrelfyklfkedilsaikegrvkkdyktilqeitqkrwkerpeyrlisvegphh
    kkkfiveakikeyrtlgegkskkeaeqraaeeliklleese
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yyoB (B:)
    kmleqlekklgytfkdksllekalthvsyskkehyetleflgdalvnffivdllvqyspn
    kregflsplkayliseeffnllaqklelhkfirikrgkinetiigdvfkalwaavyidsg
    rdanftrelfyklfkedilsaikegrvkkdyktilqeitqkrwkerpeyrlisvegphhk
    kkfiveakikeyrtlgegkskkeaeqraaeelikllees
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    No sequence available.