PDB entry 1yyn

View 1yyn on RCSB PDB site
Description: A common binding site for disialyllactose and a tri-peptide in the C-fragment of tetanus neurotoxin
Class: hydrolase
Keywords: Tetanus toxin, GD3, Ganglioside, x-ray crystallography, beta-trefoil, inhibitors, HYDROLASE
Deposited on 2005-02-25, released 2005-03-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-08-04, with a file datestamp of 2009-07-31.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.255
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Tetanus toxin
    Species: Clostridium tetani [TaxId:1513]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1yyna1, d1yyna2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1yynA (A:)
    edidvilkkstilnldinndiisdisgfnssvitypdaqlvpgingkaihlvnnessevi
    vhkamdieyndmfnnftvsfwlrvpkvsashleqygtneysiissmkkhslsigsgwsvs
    lkgnnliwtlkdsagevrqitfrdlpdkfnaylankwvfititndrlssanlyingvlmg
    saeitglgairednnitlkldrcnnnnqyvsidkfrifckalnpkeieklytsylsitfl
    rdfwgnplrydteyylipvassskdvqlknitdymyltnapsytngklniyyrrlynglk
    fiikrytpnneidsfvksgdfiklyvsynnnehivgypkdgnafnnldrilrvgynapgi
    plykkmeavklrdlktysvqlklyddknaslglvgthngqigndpnrdiliasnwyfnhl
    kdkilgcdwyfvptdegwtnd