PDB entry 1yyk

View 1yyk on RCSB PDB site
Description: Crystal structure of RNase III from Aquifex Aeolicus complexed with double-stranded RNA at 2.5-angstrom resolution
Class: hydrolase/RNA
Keywords: Ribonuclease III, double-stranded RNA, RNA interference, endonucleolytic cleavage, HYDROLASE/RNA COMPLEX
Deposited on 2005-02-25, released 2005-11-22
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.226
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ribonuclease III
    Species: Aquifex aeolicus [TaxId:63363]
    Gene: rnc
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1yyka1, d1yyka2
  • Chain 'B':
    Compound: Ribonuclease III
    Species: Aquifex aeolicus [TaxId:63363]
    Gene: rnc
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1yykb1, d1yykb2
  • Chain 'C':
    Compound: 5'-r(*cp*gp*cp*gp*ap*ap*up*up*cp*gp*cp*g)-3'
  • Chain 'D':
    Compound: 5'-r(*cp*gp*cp*gp*ap*ap*up*up*cp*gp*cp*g)-3'
  • Chain 'E':
    Compound: 5'-r(*cp*gp*cp*gp*ap*ap*up*up*cp*gp*cp*g)-3'
  • Chain 'F':
    Compound: 5'-r(*cp*gp*cp*gp*ap*ap*up*up*cp*gp*cp*g)-3'
  • Heterogens: TRS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1yykA (A:)
    mkmleqlekklgytfkdksllekalthvsyskkehyetleflgdalvnffivdllvqysp
    nkregflsplkayliseeffnllaqklelhkfirikrgkinetiigdvfealwaavyids
    grdanftrelfyklfkedilsaikegrvkkdyktilqeitqkrwkerpeyrlisvegphh
    kkkfiveakikeyrtlgegkskkeaeqraaeeliklleese
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1yykB (B:)
    mkmleqlekklgytfkdksllekalthvsyskkehyetleflgdalvnffivdllvqysp
    nkregflsplkayliseeffnllaqklelhkfirikrgkinetiigdvfealwaavyids
    grdanftrelfyklfkedilsaikegrvkkdyktilqeitqkrwkerpeyrlisvegphh
    kkkfiveakikeyrtlgegkskkeaeqraaeeliklleese
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    No sequence available.