PDB entry 1yyh

View 1yyh on RCSB PDB site
Description: Crystal structure of the human Notch 1 ankyrin domain
Class: cell cycle,transcription
Keywords: ankyrin repeats; Notch 1, CELL CYCLE,TRANSCRIPTION
Deposited on 2005-02-25, released 2005-08-16
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-19.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.163
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Notch 1, ankyrin domain
    Species: Homo sapiens [TaxId:9606]
    Gene: NOTCH1, TAN1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P46531 (Start-242)
      • expression tag (243)
    Domains in SCOPe 2.04: d1yyha_
  • Chain 'B':
    Compound: Notch 1, ankyrin domain
    Species: Homo sapiens [TaxId:9606]
    Gene: NOTCH1, TAN1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1yyhb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1yyhA (A:)
    mdvnvrgpdgftplmiascsgggletgnseeeedapavisdfiyqgaslhnqtdrtgeta
    lhlaarysrsdaakrlleasadaniqdnmgrtplhaavsadaqgvfqilirnratdldar
    mhdgttplilaarlavegmledlinshadvnavddlgksalhwaaavnnvdaavvllkng
    ankdmqnnreetplflaaregsyetakvlldhfanrditdhmdrlprdiaqermhhdivr
    lldlehhhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yyhA (A:)
    qtdrtgetalhlaarysrsdaakrlleasadaniqdnmgrtplhaavsadaqgvfqilir
    nratdldarmhdgttplilaarlavegmledlinshadvnavddlgksalhwaaavnnvd
    aavvllkngankdmqnnreetplflaaregsyetakvlldhfanrditdhmdrlprdiaq
    ermhhdivrlldl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1yyhB (B:)
    mdvnvrgpdgftplmiascsgggletgnseeeedapavisdfiyqgaslhnqtdrtgeta
    lhlaarysrsdaakrlleasadaniqdnmgrtplhaavsadaqgvfqilirnratdldar
    mhdgttplilaarlavegmledlinshadvnavddlgksalhwaaavnnvdaavvllkng
    ankdmqnnreetplflaaregsyetakvlldhfanrditdhmdrlprdiaqermhhdivr
    lldlehhhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yyhB (B:)
    rtgetalhlaarysrsdaakrlleasadaniqdnmgrtplhaavsadaqgvfqilirnra
    tdldarmhdgttplilaarlavegmledlinshadvnavddlgksalhwaaavnnvdaav
    vllkngankdmqnnreetplflaaregsyetakvlldhfanrditdhmdrlprdiaqerm
    hhdivrlld