PDB entry 1yyg

View 1yyg on RCSB PDB site
Description: Manganese peroxidase complexed with Cd(II) inhibitor
Class: oxidoreductase
Keywords: Peroxidase, heme enzyme, Mn(II) binding protein, glycosylation, OXIDOREDUCTASE
Deposited on 2005-02-24, released 2005-05-10
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-29, with a file datestamp of 2020-07-04.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: N/A
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Peroxidase manganese-dependent I
    Species: Phanerochaete chrysosporium [TaxId:5306]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1yyga_
  • Heterogens: MAN, CA, NA, HEM, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1yygA (A:)
    avcpdgtrvshaaccafiplaqdlqetifqnecgedahevirltfhdaiaisrsqgpkag
    ggadgsmllfptvepnfsanngiddsvnnlipfmqkhntisaadlvqfagavalsncpga
    prleflagrpnktiaavdglipepqdsvtkilqrfedaggftpfevvsllashsvaradk
    vdqtidaapfdstpftfdtqvflevllkgvgfpgsanntgevasplplgsgsdtgemrlq
    sdfalahdprtaciwqgfvneqafmaasfraamsklavlghnrnslidcsdvvpvpkpat
    gqpamfpastgpqdlelscpserfptlttqpgasqsliahcpdgsmscpgvqfngpa