PDB entry 1yyf

View 1yyf on RCSB PDB site
Description: Correction of X-ray Intensities from an HslV-HslU co-crystal containing lattice translocation defects
Class: chaperone/hydrolase
Keywords: Lattice translocation Defect, HslV-HslU, ATP-dependent proteolysis, Quaternary Structure, CHAPERONE/HYDROLASE COMPLEX
Deposited on 2005-02-24, released 2005-07-12
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 4.16 Å
R-factor: 0.28
AEROSPACI score: -0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ATP-dependent hsl protease ATP-binding subunit hslu
    Species: Escherichia coli [TaxId:562]
    Gene: hslU, htpI
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1yyfa1
  • Chain 'B':
    Compound: ATP-dependent hsl protease ATP-binding subunit hslu
    Species: Escherichia coli [TaxId:562]
    Gene: hslU, htpI
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1yyfb1
  • Chain 'C':
    Compound: ATP-dependent protease hslv
    Species: Bacillus subtilis [TaxId:1423]
    Gene: hslV, clpQ, codW
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1yyfc1
  • Chain 'D':
    Compound: ATP-dependent protease hslv
    Species: Bacillus subtilis [TaxId:1423]
    Gene: hslV, clpQ, codW
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1yyfd1
  • Heterogens: ADP

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1yyfA (A:)
    msemtpreivseldkhiigqdnakrsvaialrnrwrrmqlneelrhevtpknilmigptg
    vgkteiarrlaklanapfikveatkftevgyvgkevdsiirdltdaavkmvrvqaieknr
    yraeelaeerildvlippaknnwgqteqqqepsaarqafrkklregqlddkeieidlaaa
    pmgveimappgmeemtsqlqsmfqnlggqkqkarklkikdamkllieeeaaklvnpeelk
    qdaidaveqhgivfideidkickrgessgpdvsregvqrdllplvegctvstkhgmvktd
    hilfiasgafqiakpsdlipelqgrlpirvelqalttsdferiltepnasitvqykalma
    tegvnieftdsgikriaeaawqvnestenigarrlhtvlerlmeeisydasdlsgqniti
    dadyvskhldalvadedlsrfil
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yyfA (A:)
    msemtpreivseldkhiigqdnakrsvaialrnrwrrmqlneelrhevtpknilmigptg
    vgkteiarrlaklanapfikveatkftevgyvgkevdsiirdltdaavkmvrvqaieknr
    yraeelaeerildvlippaknnwgqteqqqepsaarqafrkklregqlddkeiekqkark
    lkikdamkllieeeaaklvnpeelkqdaidaveqhgivfideidkickrgessgpdvsre
    gvqrdllplvegctvstkhgmvktdhilfiasgafqiakpsdlipelqgrlpirvelqal
    ttsdferiltepnasitvqykalmategvnieftdsgikriaeaawqvnestenigarrl
    htvlerlmeeisydasdlsgqnitidadyvskhldalvadedlsrfil
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1yyfB (B:)
    msemtpreivseldkhiigqdnakrsvaialrnrwrrmqlneelrhevtpknilmigptg
    vgkteiarrlaklanapfikveatkftevgyvgkevdsiirdltdaavkmvrvqaieknr
    yraeelaeerildvlippaknnwgqteqqqepsaarqafrkklregqlddkeieidlaaa
    pmgveimappgmeemtsqlqsmfqnlggqkqkarklkikdamkllieeeaaklvnpeelk
    qdaidaveqhgivfideidkickrgessgpdvsregvqrdllplvegctvstkhgmvktd
    hilfiasgafqiakpsdlipelqgrlpirvelqalttsdferiltepnasitvqykalma
    tegvnieftdsgikriaeaawqvnestenigarrlhtvlerlmeeisydasdlsgqniti
    dadyvskhldalvadedlsrfil
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yyfB (B:)
    msemtpreivseldkhiigqdnakrsvaialrnrwrrmqlneelrhevtpknilmigptg
    vgkteiarrlaklanapfikveatkftevgyvgkevdsiirdltdaavkmvrvqaieknr
    yraeelaeerildvlippaknnwgqteqqqepsaarqafrkklregqlddkeiekqkark
    lkikdamkllieeeaaklvnpeelkqdaidaveqhgivfideidkickrgessgpdvsre
    gvqrdllplvegctvstkhgmvktdhilfiasgafqiakpsdlipelqgrlpirvelqal
    ttsdferiltepnasitvqykalmategvnieftdsgikriaeaawqvnestenigarrl
    htvlerlmeeisydasdlsgqnitidadyvskhldalvadedlsrfil
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1yyfC (C:)
    mssfhattifavqhkgrsamsgdgqvtfgqavvmkhtarkvrklfngkvlagfagsvada
    ftlfekfeakleeyngnlkraavelakewrsdkvlrkleamlivmnqdtlllvsgtgevi
    epddgilaigsggnyalaagralkkhagesmsaseiaraaletageicvytndqiileel
    e
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yyfC (C:)
    ssfhattifavqhkgrsamsgdgqvtfgqavvmkhtarkvrklfngkvlagfagsvadaf
    tlfekfeakleeyngnlkraavelakewrsdkvlrkleamlivmnqdtlllvsgtgevie
    pddgilaigsggnyalaagralkkhagesmsaseiaraaletageicvytndqiileele
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1yyfD (D:)
    mssfhattifavqhkgrsamsgdgqvtfgqavvmkhtarkvrklfngkvlagfagsvada
    ftlfekfeakleeyngnlkraavelakewrsdkvlrkleamlivmnqdtlllvsgtgevi
    epddgilaigsggnyalaagralkkhagesmsaseiaraaletageicvytndqiileel
    e
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yyfD (D:)
    ssfhattifavqhkgrsamsgdgqvtfgqavvmkhtarkvrklfngkvlagfagsvadaf
    tlfekfeakleeyngnlkraavelakewrsdkvlrkleamlivmnqdtlllvsgtgevie
    pddgilaigsggnyalaagralkkhagesmsaseiaraaletageicvytndqiileele