PDB entry 1yyd

View 1yyd on RCSB PDB site
Description: High Resolution Crystal Structure of Manganese Peroxidase
Class: oxidoreductase
Keywords: Peroxidase, Heme enzyme, OXIDOREDUCTASE
Deposited on 2005-02-24, released 2005-05-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 1.45 Å
R-factor: N/A
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Peroxidase manganese-dependent I
    Species: Phanerochaete chrysosporium [TaxId:5306]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1yyda_
  • Heterogens: NAG, MAN, CA, MN, SO4, HEM, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1yydA (A:)
    avcpdgtrvshaaccafiplaqdlqetifqnecgedahevirltfhdaiaisrsqgpkag
    ggadgsmllfptvepnfsanngiddsvnnlipfmqkhntisaadlvqfagavalsncpga
    prleflagrpnktiaavdglipepqdsvtkilqrfedaggftpfevvsllashsvaradk
    vdqtidaapfdstpftfdtqvflevllkgvgfpgsanntgevasplplgsgsdtgemrlq
    sdfalahdprtaciwqgfvneqafmaasfraamsklavlghnrnslidcsdvvpvpkpat
    gqpamfpastgpqdlelscpserfptlttqpgasqsliahcpdgsmscpgvqfngpa