PDB entry 1yya

View 1yya on RCSB PDB site
Description: Crystal structure of TT0473, putative Triosephosphate Isomerase from Thermus thermophilus HB8
Deposited on 2005-02-24, released 2005-03-15
The last revision was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.174
AEROSPACI score: 0.61 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: triosephosphate isomerase
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: triosephosphate isomerase
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: NA, PO4, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >1yyaA (A:)
    mrrvlvagnwkmhktpsearvwfaelkrllpplqseaavlpafpilpvakevlaetqvgy
    gaqdvsahkegaytgevsarmlsdlgcryaivghserrryhgetdalvaekakrlleegi
    tpilcvgeplevrekgeavpytlrqlrgslegveppgpealviayepvwaigtgknatpe
    daeamhqairkalserygeafasrvrilyggsvnpknfadllsmpnvdgglvggaslele
    sflallriag
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records:
    >1yyaB (B:)
    mrrvlvagnwkmhktpsearvwfaelkrllpplqseaavlpafpilpvakevlaetqvgy
    gaqdvsahkegaytgevsarmlsdlgcryaivghserrryhgetdalvaekakrlleegi
    tpilcvgeplevrekgeavpytlrqlrgslegveppgpealviayepvwaigtgknatpe
    daeamhqairkalserygeafasrvrilyggsvnpknfadllsmpnvdgglvggaslele
    sflallriag