PDB entry 1yy7

View 1yy7 on RCSB PDB site
Description: Crystal structure of stringent starvation protein A (SspA), an RNA polymerase-associated transcription factor
Class: transcription
Keywords: GST fold, TRANSCRIPTION
Deposited on 2005-02-23, released 2005-03-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.02 Å
R-factor: 0.179
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: stringent starvation protein A
    Species: Yersinia pestis [TaxId:632]
    Gene: sspA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1yy7a1, d1yy7a2
  • Chain 'B':
    Compound: stringent starvation protein A
    Species: Yersinia pestis [TaxId:632]
    Gene: sspA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1yy7b1, d1yy7b2
  • Heterogens: CIT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1yy7A (A:)
    mavaankrsvmtlfsgptdifshqvrivlaekgvsveieqveadnlpqdlidlnpyrtvp
    tlvdreltlyesriimeylderfphpplmpvypvargssrlmmhriehdwysllykieqg
    naqeaeaarkqlreellsiapvfnetpffmseefslvdcylapllwrlpvlgieftgags
    kelkgymtrvferdaflaslteaeremhlktrs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yy7A (A:)
    aankrsvmtlfsgptdifshqvrivlaekgvsveieqveadnlpqdlidlnpyrtvptlv
    dreltlyesriimeylderfphpplmpvypvargssrlmmhriehdwysllykieqgnaq
    eaeaarkqlreellsiapvfnetpffmseefslvdcylapllwrlpvlgieftgagskel
    kgymtrvferdaflaslteaeremhl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1yy7B (B:)
    mavaankrsvmtlfsgptdifshqvrivlaekgvsveieqveadnlpqdlidlnpyrtvp
    tlvdreltlyesriimeylderfphpplmpvypvargssrlmmhriehdwysllykieqg
    naqeaeaarkqlreellsiapvfnetpffmseefslvdcylapllwrlpvlgieftgags
    kelkgymtrvferdaflaslteaeremhlktrs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yy7B (B:)
    vmtlfsgptdifshqvrivlaekgvsveieqveadnlpqdlidlnpyrtvptlvdreltl
    yesriimeylderfphpplmpvypvargssrlmmhriehdwysllykieqgnaqeaeaar
    kqlreellsiapvfnetpffmseefslvdcylapllwrlpvlgieftgagskelkgymtr
    vferdaflaslteaeremhlktrs