PDB entry 1yy6

View 1yy6 on RCSB PDB site
Description: the crystal structure of the n-terminal domain of hausp/usp7 complexed with an ebna1 peptide
Deposited on 2005-02-23, released 2005-04-05
The last revision was dated 2016-12-21, with a file datestamp of 2016-12-16.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: N/A
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ubiquitin carboxyl-terminal hydrolase 7
    Species: Homo sapiens [TaxId:9606]
    Gene: USP7, HAUSP
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Epstein-Barr nuclear antigen-1
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 1YY6 (0-End)
  • Heterogens: NA, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >1yy6A (A:)
    gshtaeedmeddtswrseatfqftverfsrlsesvlsppcfvrnlpwkimvmprfypdrp
    hqksvgfflqcnaesdstswschaqavlkiinyrddeksfsrrishlffhkendwgfsnf
    mawsevtdpekgfidddkvtfevfvqadaphgvaw
    

    Sequence, based on observed residues (ATOM records):
    >1yy6A (A:)
    tswrseatfqftverfsrlsesvlsppcfvrnlpwkimvmprfqksvgfflqcnaesdst
    swschaqavlkiinyrddeksfsrrishlffhkendwgfsnfmawsevtdpekgfidddk
    vtfevfvqadaphgvaw
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >1yy6B (B:)
    dpgegpstgp
    

    Sequence, based on observed residues (ATOM records):
    >1yy6B (B:)
    dpgegpst