PDB entry 1yy5

View 1yy5 on RCSB PDB site
Description: Crystal structure of Fms1, a polyamine oxidase from Yeast
Deposited on 2005-02-23, released 2005-03-08
The last revision was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.249
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: FMS1 protein
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: FMS1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P50264 (Start-507)
      • expression tag (508-512)
  • Chain 'B':
    Compound: FMS1 protein
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: FMS1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P50264 (Start-507)
      • expression tag (508)
  • Heterogens: FAD, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >1yy5A (A:)
    mntvspakkkviiigagiaglkaastlhqngiqdclvleardrvggrlqtvtgyqgrkyd
    igaswhhdtltnplfleeaqlslndgrtrfvfdddnfiyideergrvdhdkellleivdn
    emskfaelefhqhlgvsdcsffqlvmkyllqrrqfltndqirylpqlcrylelwhgldwk
    llsakdtyfghqgrnafalnydsvvqriaqsfpqnwlklscevksitrepsknvtvnced
    gtvynadyviitvpqsvlnlsvqpeknlrgriefqpplkpviqdafdkihfgalgkvife
    feeccwsnesskivtlanstnefveivrnaenldeldsmleredsqkhtsvtcwsqplff
    vnlskstgvasfmmlmqapltnhiesiredkerlfsffqpvlnkimkcldsedvidgmrp
    ienianankpvlrniivsnwtrdpysrgaysacfpgddpvdmvvamsngqdsrirfageh
    timdgagcaygawesgrreatrisdllklehhh
    

    Sequence, based on observed residues (ATOM records):
    >1yy5A (A:)
    pakkkviiigagiaglkaastlhqngiqdclvleardrvggrlqtvtgyqgrkydigasw
    hhdtltnplfleeaqlslndgrtrfvfdddnfiyideergrvdhdkellleivdnemskf
    aelefhqhlgvsdcsffqlvmkyllqrrqfltndqirylpqlcrylelwhgldwkllsak
    dtyfghqgrnafalnydsvvqriaqsfpqnwlklscevksitrepsknvtvncedgtvyn
    adyviitvpqsvlnlsvqpeknlrgriefqpplkpviqdafdkihfgalgkvifefeecc
    wsnesskivtlanstnefveivrnaenldeldsmlertsvtcwsqplffvnlskstgvas
    fmmlmqapltnhiesiredkerlfsffqpvlnkimkcldsedvidgmrpienianankpv
    lrniivsnwtrdpysrgaysacfpvdmvvamsngqdsrirfagehtimdgagcaygawes
    grreatrisdllklehhh
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >1yy5B (B:)
    mntvspakkkviiigagiaglkaastlhqngiqdclvleardrvggrlqtvtgyqgrkyd
    igaswhhdtltnplfleeaqlslndgrtrfvfdddnfiyideergrvdhdkellleivdn
    emskfaelefhqhlgvsdcsffqlvmkyllqrrqfltndqirylpqlcrylelwhgldwk
    llsakdtyfghqgrnafalnydsvvqriaqsfpqnwlklscevksitrepsknvtvnced
    gtvynadyviitvpqsvlnlsvqpeknlrgriefqpplkpviqdafdkihfgalgkvife
    feeccwsnesskivtlanstnefveivrnaenldeldsmleredsqkhtsvtcwsqplff
    vnlskstgvasfmmlmqapltnhiesiredkerlfsffqpvlnkimkcldsedvidgmrp
    ienianankpvlrniivsnwtrdpysrgaysacfpgddpvdmvvamsngqdsrirfageh
    timdgagcaygawesgrreatrisdllklehhh
    

    Sequence, based on observed residues (ATOM records):
    >1yy5B (B:)
    kkkviiigagiaglkaastlhqngiqdclvleardrvggrlqtvtgyqgrkydigaswhh
    dtltnplfleeaqlslndgrtrfvfdddnfiyideergrvdhdkellleivdnemskfae
    lefhsdcsffqlvmkyllqrrqfltndqirylpqlcrylelwhgldwkllsakdtyfghq
    grnafalnydsvvqriaqsfpqnwlklscevksitrepsknvtvncedgtvynadyviit
    vpqsvlnlsvqpeknlrgriefqpplkpviqdafdkihfgalgkvifefeeccwsnessk
    ivtlanstnefveivrnaenldeldsmlertsvtcwsqplffvnlskstgvasfmmlmqa
    pltnhiesiredkerlfsffqpvlnkimkcldsedvidgmrpienianankpvlrniivs
    nwtrdpysrgaysacfpvdmvvamsngqdsrirfagehtimdgagcaygawesgrreatr
    isdllkl