PDB entry 1yy4

View 1yy4 on RCSB PDB site
Description: Crystal structure of estrogen receptor beta complexed with 1-chloro-6-(4-hydroxy-phenyl)-naphthalen-2-ol
Class: transcription
Keywords: estrogen receptor, estrogen receptor beta, er-beta, er, estrogen, nuclear receptor, transcription factor, agonist
Deposited on 2005-02-23, released 2006-02-28
The last revision prior to the SCOP 1.75 freeze date was dated 2006-02-28, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.214
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Estrogen receptor beta
    Species: HOMO SAPIENS
    Gene: ESR2, ESTRB, NR3A2
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1yy4a1
  • Chain 'B':
    Compound: Estrogen receptor beta
    Species: HOMO SAPIENS
    Gene: ESR2, ESTRB, NR3A2
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1yy4b1
  • Chain 'C':
    Compound: steroid receptor coactivator-1
    Species: synthetic, synthetic
  • Chain 'D':
    Compound: steroid receptor coactivator-1
    Species: synthetic, synthetic
  • Heterogens: 4NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1yy4A (A:)
    lspeqlvltlleaepphvlisrpsapfteasmmmsltkladkelvhmiswakkipgfvel
    slfdqvrllescwmevlmmglmwrsidhpgklifapdlvldrdegkcvegileifdmlla
    ttsrfrelklqhkeylcvkamillnssmyplvtatqdadssrklahllnavtdalvwvia
    ksgissqqqsmrlanllmllshvrhasnkgmehllnmkcknvvpvydlllemlnahvlrg
    ckssitgsecspaedskskegsqnpqsq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yy4A (A:)
    lspeqlvltlleaepphvlisrpsapfteasmmmsltkladkelvhmiswakkipgfvel
    slfdqvrllescwmevlmmglmwrsidhpgklifapdlvldrdegkcvegileifdmlla
    ttsrfrelklqhkeylcvkamillnssmdssrklahllnavtdalvwviaksgissqqqs
    mrlanllmllshvrhasnkgmehllnmkcknvvpvydlllemlna
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1yy4B (B:)
    lspeqlvltlleaepphvlisrpsapfteasmmmsltkladkelvhmiswakkipgfvel
    slfdqvrllescwmevlmmglmwrsidhpgklifapdlvldrdegkcvegileifdmlla
    ttsrfrelklqhkeylcvkamillnssmyplvtatqdadssrklahllnavtdalvwvia
    ksgissqqqsmrlanllmllshvrhasnkgmehllnmkcknvvpvydlllemlnahvlrg
    ckssitgsecspaedskskegsqnpqsq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yy4B (B:)
    lspeqlvltlleaepphvlisrpsapfteasmmmsltkladkelvhmiswakkipgfvel
    slfdqvrllescwmevlmmglmwrsidhpgklifapdlvldrdegkcvegileifdmlla
    ttsrfrelklqhkeylcvkamillnssmdssrklahllnavtdalvwviaksgissqqqs
    mrlanllmllshvrhasnkgmehllnmkcknvvpvydlllemlna
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.