PDB entry 1yy3

View 1yy3 on RCSB PDB site
Description: Structure of S-Adenosylmethionine:tRNA Ribosyltransferase-Isomerase (QueA)
Class: isomerase
Keywords: beta-barrel, QueA, Bacillus subtilis, Quein Queuosine, S-Adenosylmethionine:tRNA Ribosyltransferase-Isomerase, tRNA-modification
Deposited on 2005-02-23, released 2006-03-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.88 Å
R-factor: 0.364
AEROSPACI score: 0.06 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: S-adenosylmethionine:tRNA ribosyltransferase-isomerase
    Species: Bacillus subtilis [TaxId:1423]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1yy3a_
  • Chain 'B':
    Compound: S-adenosylmethionine:tRNA ribosyltransferase-isomerase
    Species: Bacillus subtilis [TaxId:1423]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1yy3b_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1yy3A (A:)
    gplgskvdlfdfelperliaqvpleqrdasrlmvldkhtgeltdssfkhiisffnegdcl
    vlnntrvlparlfgtkedtgakvellllkqetgdkwetlakpakrvkkgtvvtfgdgrlk
    aicteelehggrkmefqydgifyevleslgemplppyikeqlddkeryqtvyskeigsaa
    aptaglhfteeilqqlkdkgvqiefitlhvglgtfrpvsadeveehnmhaefyqmseeta
    aalnkvrenggriisvgttstrtletiagehdgqfkassgwtsifiypgyefkaidgmit
    nfhlpksslimlvsalagrenilraynhaveeeyrffsfgdamlii
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yy3A (A:)
    dlfdfelperliaqvpleqrdasrlmvldkhtgeltdssfkhiisffnegdclvlnntrv
    lparlfgtkedtgakvellllkqetgdkwetlakpakrvkkgtvvtfgdgrlkaicteel
    ehggrkmefqydgifyevleslgemplppyikeqlddkeaaaptaglhfteeilqqlkdk
    gvqiefitlhvglgtfrmhaefyqmseetaaalnkvrenggriisvgttstrtletiage
    hdgqfkassgwtsifiypgyefkaidgmitnfhlpksslimlvsalagrenilraynhav
    eeeyrffsfgdamli
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1yy3B (B:)
    gplgskvdlfdfelperliaqvpleqrdasrlmvldkhtgeltdssfkhiisffnegdcl
    vlnntrvlparlfgtkedtgakvellllkqetgdkwetlakpakrvkkgtvvtfgdgrlk
    aicteelehggrkmefqydgifyevleslgemplppyikeqlddkeryqtvyskeigsaa
    aptaglhfteeilqqlkdkgvqiefitlhvglgtfrpvsadeveehnmhaefyqmseeta
    aalnkvrenggriisvgttstrtletiagehdgqfkassgwtsifiypgyefkaidgmit
    nfhlpksslimlvsalagrenilraynhaveeeyrffsfgdamlii
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yy3B (B:)
    dlfdfelperliaqvpleqrdasrlmvldkhtgeltdssfkhiisffnegdclvlnntrv
    lparlfgtkedtgakvellllkqetgdkwetlakpakrvkkgtvvtfgdgrlkaicteel
    ehggrkmefqydgifyevleslgemplppyikeqlddkeaaaptaglhfteeilqqlkdk
    gvqiefitlhvglgtfrmhaefyqmseetaaalnkvrenggriisvgttstrtletiage
    hdgqfkassgwtsifiypgyefkaidgmitnfhlpksslimlvsalagrenilraynhav
    eeeyrffsfgdamli