PDB entry 1yxx

View 1yxx on RCSB PDB site
Description: Crystal Structure of Kinase Pim1 in complex with (3E)-3-[(4-HYDROXYPHENYL)IMINO]-1H-INDOL-2(3H)-ONE
Class: transferase
Keywords: Ser/Thr protein kinase, TRANSFERASE
Deposited on 2005-02-22, released 2005-04-26
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.218
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Proto-oncogene serine/threonine-protein kinase Pim-1
    Species: Homo sapiens [TaxId:9606]
    Gene: PIM1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1yxxa_
  • Heterogens: IMD, LI7, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1yxxA (A:)
    kekeplesqyqvgpllgsggfgsvysgirvsdnlpvaikhvekdrisdwgelpngtrvpm
    evvllkkvssgfsgvirlldwferpdsfvlilerpepvqdlfdfitergalqeelarsff
    wqvleavrhchncgvlhrdikdenilidlnrgelklidfgsgallkdtvytdfdgtrvys
    ppewiryhryhgrsaavwslgillydmvcgdipfehdeeiirgqvffrqrvssecqhlir
    wclalrpsdrptfeeiqnhpwmqdvllpqetaeihlhslspgpskvdhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yxxA (A:)
    plesqyqvgpllgsggfgsvysgirvsdnlpvaikhvekdrisdwgelpngtrvpmevvl
    lkkvssgfsgvirlldwferpdsfvlilerpepvqdlfdfitergalqeelarsffwqvl
    eavrhchncgvlhrdikdenilidlnrgelklidfgsgallkdtvytdfdgtrvysppew
    iryhryhgrsaavwslgillydmvcgdipfehdeeiirgqvffrqrvssecqhlirwcla
    lrpsdrptfeeiqnhpwmqdvllpqetaeihlhs