PDB entry 1yxw

View 1yxw on RCSB PDB site
Description: A common binding site for disialyllactose and a tri-peptide in the C-fragment of tetanus neurotoxin
Class: hydrolase
Keywords: Tetanus toxin, GD3, Ganglioside, x-ray crystallography, beta-trefoil, inhibitors, HYDROLASE
Deposited on 2005-02-22, released 2005-03-15
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.224
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Tetanus toxin (Tentoxylysin)
    Species: Clostridium tetani [TaxId:1513]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1yxwa1, d1yxwa2
  • Heterogens: TYR, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1yxwA (A:)
    edidvilkkstilnldinndiisdisgfnssvitypdaqlvpgingkaihlvnnessevi
    vhkamdieyndmfnnftvsfwlrvpkvsashleqygtneysiissmkkhslsigsgwsvs
    lkgnnliwtlkdsagevrqitfrdlpdkfnaylankwvfititndrlssanlyingvlmg
    saeitglgairednnitlkldrcnnnnqyvsidkfrifckalnpkeieklytsylsitfl
    rdfwgnplrydteyylipvassskdvqlknitdymyltnapsytngklniyyrrlynglk
    fiikrytpnneidsfvksgdfiklyvsynnnehivgypkdgnafnnldrilrvgynapgi
    plykkmeavklrdlktysvqlklyddknaslglvgthngqigndpnrdiliasnwyfnhl
    kdkilgcdwyfvptdegwtnd