PDB entry 1yxu

View 1yxu on RCSB PDB site
Description: Crystal Structure of Kinase Pim1 in Complex with AMP
Class: Transferase
Keywords: Ser/Thr protein kinase, Transferase
Deposited on 2005-02-22, released 2005-04-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.24 Å
R-factor: 0.228
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Proto-oncogene serine/threonine-protein kinase Pim-1
    Species: Homo sapiens [TaxId:9606]
    Gene: PIM1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1yxua_
  • Chain 'B':
    Compound: Proto-oncogene serine/threonine-protein kinase Pim-1
    Species: Homo sapiens [TaxId:9606]
    Gene: PIM1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1yxub_
  • Chain 'C':
    Compound: Proto-oncogene serine/threonine-protein kinase Pim-1
    Species: Homo sapiens [TaxId:9606]
    Gene: PIM1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1yxuc_
  • Chain 'D':
    Compound: Proto-oncogene serine/threonine-protein kinase Pim-1
    Species: Homo sapiens [TaxId:9606]
    Gene: PIM1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1yxud_
  • Heterogens: IMD, AMP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1yxuA (A:)
    kekeplesqyqvgpllgsggfgsvysgirvsdnlpvaikhvekdrisdwgelpngtrvpm
    evvllkkvssgfsgvirlldwferpdsfvlilerpepvqdlfdfitergalqeelarsff
    wqvleavrhchncgvlhrdikdenilidlnrgelklidfgsgallkdtvytdfdgtrvys
    ppewiryhryhgrsaavwslgillydmvcgdipfehdeeiirgqvffrqrvssecqhlir
    wclalrpsdrptfeeiqnhpwmqdvllpqetaeihlhslspgpskvdhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yxuA (A:)
    plesqyqvgpllgsggfgsvysgirvsdnlpvaikhvekdrisdwgelpngtrvpmevvl
    lkkvssgfsgvirlldwferpdsfvlilerpepvqdlfdfitergalqeelarsffwqvl
    eavrhchncgvlhrdikdenilidlnrgelklidfgsgallkdtvytdfdgtrvysppew
    iryhryhgrsaavwslgillydmvcgdipfehdeeiirgqvffrqrvssecqhlirwcla
    lrpsdrptfeeiqnhpwmqdvllpqetaeihlh
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1yxuB (B:)
    kekeplesqyqvgpllgsggfgsvysgirvsdnlpvaikhvekdrisdwgelpngtrvpm
    evvllkkvssgfsgvirlldwferpdsfvlilerpepvqdlfdfitergalqeelarsff
    wqvleavrhchncgvlhrdikdenilidlnrgelklidfgsgallkdtvytdfdgtrvys
    ppewiryhryhgrsaavwslgillydmvcgdipfehdeeiirgqvffrqrvssecqhlir
    wclalrpsdrptfeeiqnhpwmqdvllpqetaeihlhslspgpskvdhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yxuB (B:)
    plesqyqvgpllgsggfgsvysgirvsdnlpvaikhvekdrisdwgelpngtrvpmevvl
    lkkvssgfsgvirlldwferpdsfvlilerpepvqdlfdfitergalqeelarsffwqvl
    eavrhchncgvlhrdikdenilidlnrgelklidfgsgallkdtvytdfdgtrvysppew
    iryhryhgrsaavwslgillydmvcgdipfehdeeiirgqvffrqrvssecqhlirwcla
    lrpsdrptfeeiqnhpwmqdvllpqetaeihlh
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1yxuC (C:)
    kekeplesqyqvgpllgsggfgsvysgirvsdnlpvaikhvekdrisdwgelpngtrvpm
    evvllkkvssgfsgvirlldwferpdsfvlilerpepvqdlfdfitergalqeelarsff
    wqvleavrhchncgvlhrdikdenilidlnrgelklidfgsgallkdtvytdfdgtrvys
    ppewiryhryhgrsaavwslgillydmvcgdipfehdeeiirgqvffrqrvssecqhlir
    wclalrpsdrptfeeiqnhpwmqdvllpqetaeihlhslspgpskvdhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yxuC (C:)
    lesqyqvgpllgsggfgsvysgirvsdnlpvaikhvekdrisdwgelpngtrvpmevvll
    kkvssgfsgvirlldwferpdsfvlilerpepvqdlfdfitergalqeelarsffwqvle
    avrhchncgvlhrdikdenilidlnrgelklidfgsgallkdtvytdfdgtrvysppewi
    ryhryhgrsaavwslgillydmvcgdipfehdeeiirgqvffrqrvssecqhlirwclal
    rpsdrptfeeiqnhpwmqdvllpqetaeihlh
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1yxuD (D:)
    kekeplesqyqvgpllgsggfgsvysgirvsdnlpvaikhvekdrisdwgelpngtrvpm
    evvllkkvssgfsgvirlldwferpdsfvlilerpepvqdlfdfitergalqeelarsff
    wqvleavrhchncgvlhrdikdenilidlnrgelklidfgsgallkdtvytdfdgtrvys
    ppewiryhryhgrsaavwslgillydmvcgdipfehdeeiirgqvffrqrvssecqhlir
    wclalrpsdrptfeeiqnhpwmqdvllpqetaeihlhslspgpskvdhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yxuD (D:)
    plesqyqvgpllgsggfgsvysgirvsdnlpvaikhvekdrisdwgelpngtrvpmevvl
    lkkvssgfsgvirlldwferpdsfvlilerpepvqdlfdfitergalqeelarsffwqvl
    eavrhchncgvlhrdikdenilidlnrgelklidfgsgallkdtvytdfdgtrvysppew
    iryhryhgrsaavwslgillydmvcgdipfehdeeiirgqvffrqrvssecqhlirwcla
    lrpsdrptfeeiqnhpwmqdvllpqetaeihlh