PDB entry 1yxs

View 1yxs on RCSB PDB site
Description: Crystal Structure of Kinase Pim1 with P123M mutation
Class: transferase
Keywords: Ser/Thr protein kinase, TRANSFERASE
Deposited on 2005-02-22, released 2005-04-26
The last revision prior to the SCOPe 2.08 freeze date was dated 2015-06-24, with a file datestamp of 2015-06-19.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: N/A
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Proto-oncogene serine/threonine-protein kinase Pim-1
    Species: Homo sapiens [TaxId:9606]
    Gene: PIM1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P11309
      • engineered (94)
    Domains in SCOPe 2.08: d1yxsa_
  • Heterogens: IMD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1yxsA (A:)
    kekeplesqyqvgpllgsggfgsvysgirvsdnlpvaikhvekdrisdwgelpngtrvpm
    evvllkkvssgfsgvirlldwferpdsfvlilermepvqdlfdfitergalqeelarsff
    wqvleavrhchncgvlhrdikdenilidlnrgelklidfgsgallkdtvytdfdgtrvys
    ppewiryhryhgrsaavwslgillydmvcgdipfehdeeiirgqvffrqrvssecqhlir
    wclalrpsdrptfeeiqnhpwmqdvllpqetaeihlhslspgpskvdhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yxsA (A:)
    plesqyqvgpllgsggfgsvysgirvsdnlpvaikhvekdrisdwgelpngtrvpmevvl
    lkkvssgfsgvirlldwferpdsfvlilermepvqdlfdfitergalqeelarsffwqvl
    eavrhchncgvlhrdikdenilidlnrgelklidfgsgallkdtvytdfdgtrvysppew
    iryhryhgrsaavwslgillydmvcgdipfehdeeiirgqvffrqrvssecqhlirwcla
    lrpsdrptfeeiqnhpwmqdvllpqetaeihlhs