PDB entry 1yxr

View 1yxr on RCSB PDB site
Description: NMR Structure of VPS4A MIT Domain
Class: protein trafficking
Keywords: VPS4; MIT domain
Deposited on 2005-02-22, released 2005-09-06
The last revision prior to the SCOP 1.75 freeze date was dated 2005-09-06, with a file datestamp of 2007-06-04.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: vacuolar protein sorting factor 4A
  Species: HOMO SAPIENS
  Gene: 27183
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q9UN37 (0-76)
  Domains in SCOP 1.75: d1yxra1

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1yxrA (A:)
  mttstlqkaidlvtkateedkaknyeealrlyqhaveyflhaikyeahsdkakesirakc
  vqyldraeklkdylrsk