PDB entry 1yxo

View 1yxo on RCSB PDB site
Description: Crystal Structure of pyridoxal phosphate biosynthetic protein PdxA PA0593
Class: oxidoreductase
Keywords: PA0593,PYRIDOXINE BIOSYNTHESIS,OXIDOREDUCTASE, Structural Genomics, PSI, Protein Structure Initiative, Midwest Center for Structural Genomics, MCSG, OXIDOREDUCTASE
Deposited on 2005-02-22, released 2005-04-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-10-05, with a file datestamp of 2011-09-30.
Experiment type: XRAY
Resolution: 2.01 Å
R-factor: 0.198
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 4-hydroxythreonine-4-phosphate dehydrogenase 1
    Species: Pseudomonas aeruginosa [TaxId:287]
    Gene: pdxA1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1yxoa_
  • Chain 'B':
    Compound: 4-hydroxythreonine-4-phosphate dehydrogenase 1
    Species: Pseudomonas aeruginosa [TaxId:287]
    Gene: pdxA1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1yxob_
  • Heterogens: MG, EOH, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1yxoA (A:)
    mslrfaltpgepagigpdlclllarsaqphpliaiasrtllqeragqlglaidlkdvspa
    awperpakagqlyvwdtplaapvrpgqldranaayvletltragqgcldghfagmitapv
    hkgvineagipfsghtefladlthtaqvvmmlatrglrvalatthlplrevadaisderl
    trvarilhadlrdkfgiahprilvcglnphagegghlgreeieviepclerlrgegldli
    gplpadtlftpkhlehcdavlamyhdqglpvlkykgfgaavnvtlglpiirtsvdhgtal
    dlagsgridsgslqvaletayqmaasrc
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1yxoB (B:)
    mslrfaltpgepagigpdlclllarsaqphpliaiasrtllqeragqlglaidlkdvspa
    awperpakagqlyvwdtplaapvrpgqldranaayvletltragqgcldghfagmitapv
    hkgvineagipfsghtefladlthtaqvvmmlatrglrvalatthlplrevadaisderl
    trvarilhadlrdkfgiahprilvcglnphagegghlgreeieviepclerlrgegldli
    gplpadtlftpkhlehcdavlamyhdqglpvlkykgfgaavnvtlglpiirtsvdhgtal
    dlagsgridsgslqvaletayqmaasrc