PDB entry 1yxl

View 1yxl on RCSB PDB site
Description: Crystal structure of a novel phospholipase A2 from Naja naja sagittifera at 1.5 A resolution
Class: hydrolase
Keywords: Phospholipase A2, monomer, cobra, naja naja sagittifera, Hydrolase
Deposited on 2005-02-22, released 2005-03-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 1.48 Å
R-factor: N/A
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Phospholipase A2 isoform 3
    Species: Naja sagittifera [TaxId:195058]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1yxla_
  • Heterogens: CA, PO4, ACY, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1yxlA (A:)
    nlyqfknmiqctvpsrswqdfadygcycgkggsgtpvddldrccqvhdncyneaenisgc
    rpyfktysyectqgtltckgdnnacaasvcdcdrlaaicfagapyndanynidlkarcn