PDB entry 1yxl

View 1yxl on RCSB PDB site
Description: Crystal structure of a novel phospholipase A2 from Naja naja sagittifera at 1.5 A resolution
Class: hydrolase
Keywords: Phospholipase A2, monomer, cobra, naja naja sagittifera, Hydrolase
Deposited on 2005-02-22, released 2005-03-08
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 1.48 Å
R-factor: N/A
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Phospholipase A2 isoform 3
  Species: Naja sagittifera [TaxId:195058]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P60045 (0-117)
  Domains in SCOPe 2.08: d1yxla_
• Heterogens: CA, PO4, ACY, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1yxlA (A:)
  nlyqfknmiqctvpsrswqdfadygcycgkggsgtpvddldrccqvhdncyneaenisgc
  rpyfktysyectqgtltckgdnnacaasvcdcdrlaaicfagapyndanynidlkarcn