PDB entry 1yxh

View 1yxh on RCSB PDB site
Description: Crystal structure of a novel phospholipase A2 from Naja naja sagittifera with a strong anticoagulant activity
Class: hydrolase
Keywords: PLA2, anticoagulation, monomer, HYDROLASE
Deposited on 2005-02-21, released 2005-05-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.86 Å
R-factor: 0.196
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: phospholipase a2
    Species: Naja sagittifera [TaxId:195058]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1yxha_
  • Heterogens: CA, PO4, EOH, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >1yxhA (A:)
snrpmplniyqfknmiqctvpsrswwdfadygcycgrggsgtpvddldrccqvhdncynq
aqeitgcrpkwktytyecsqgtltckgrnnacaatvcdcdrlaaicfagapyndnnynid
lkarcq

    Sequence, based on observed residues (ATOM records): (download) 
    >1yxhA (A:)
niyqfknmiqctvpsrswwdfadygcycgrggsgtpvddldrccqvhdncynqaqeitgc
rpkwktytyecsqgtltckgrnnacaatvcdcdrlaaicfagapyndnnynidlkarcq