PDB entry 1yxe

View 1yxe on RCSB PDB site
Description: Structure and inter-domain interactions of domain II from the blood stage malarial protein, apical membrane antigen 1
Deposited on 2005-02-21, released 2005-07-05
The last revision was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: apical membrane antigen 1
    Species: PLASMODIUM FALCIPARUM [TaxId:36329]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P22621 (12-139)
      • expression tag (0-11)

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >1yxeA (A:)
    mrgshhhhhhgsnakfglwvdgncediphvnefpaidlfecnklvfelsasdqpkqyeqh
    ltdyekikegfknknasmiksaflptgafkadrykshgkgynwgnyntetqkceifnvkp
    tclinnssyiattalshpie