PDB entry 1yxd

View 1yxd on RCSB PDB site
Description: Structure of E. coli dihydrodipicolinate synthase bound with allosteric inhibitor (S)-lysine to 2.0 A
Class: lyase
Keywords: dihydrodipicolinate synthase, LYASE
Deposited on 2005-02-20, released 2005-08-02
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Dihydrodipicolinate synthase
    Species: Escherichia coli [TaxId:562]
    Gene: dapA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1yxda_
  • Chain 'B':
    Compound: Dihydrodipicolinate synthase
    Species: Escherichia coli [TaxId:562]
    Gene: dapA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1yxdb_
  • Heterogens: K, CL, LYS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1yxdA (A:)
    mftgsivaivtpmdekgnvcraslkklidyhvasgtsaivsvgttgesatlnhdehadvv
    mmtldladgripviagtganataeaisltqrfndsgivgcltvtpyynrpsqeglyqhfk
    aiaehtdlpqilynvpsrtgcdllpetvgrlakvkniigikeatgnltrvnqikelvsdd
    fvllsgddasaldfmqlgghgvisvtanvaardmaqmcklaaeghfaearvinqrlmplh
    nklfvepnpipvkwackelglvatdtlrlpmtpitdsgretvraalkhagll
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1yxdB (B:)
    mftgsivaivtpmdekgnvcraslkklidyhvasgtsaivsvgttgesatlnhdehadvv
    mmtldladgripviagtganataeaisltqrfndsgivgcltvtpyynrpsqeglyqhfk
    aiaehtdlpqilynvpsrtgcdllpetvgrlakvkniigikeatgnltrvnqikelvsdd
    fvllsgddasaldfmqlgghgvisvtanvaardmaqmcklaaeghfaearvinqrlmplh
    nklfvepnpipvkwackelglvatdtlrlpmtpitdsgretvraalkhagll