PDB entry 1yxc

View 1yxc on RCSB PDB site
Description: Structure of E. coli dihydrodipicolinate synthase to 1.9 A
Class: lyase
Keywords: dihydrodipicolinate synthase
Deposited on 2005-02-20, released 2005-08-02
The last revision prior to the SCOP 1.73 freeze date was dated 2005-08-02, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.174
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Dihydrodipicolinate synthase
    Species: Escherichia coli
    Gene: dapA
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1yxca1
  • Chain 'B':
    Compound: Dihydrodipicolinate synthase
    Species: Escherichia coli
    Gene: dapA
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1yxcb1
  • Heterogens: K, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1yxcA (A:)
    mftgsivaivtpmdekgnvcraslkklidyhvasgtsaivsvgttgesatlnhdehadvv
    mmtldladgripviagtganataeaisltqrfndsgivgcltvtpyynrpsqeglyqhfk
    aiaehtdlpqilynvpsrtgcdllpetvgrlakvkniigikeatgnltrvnqikelvsdd
    fvllsgddasaldfmqlgghgvisvtanvaardmaqmcklaaeghfaearvinqrlmplh
    nklfvepnpipvkwackelglvatdtlrlpmtpitdsgretvraalkhagll
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1yxcB (B:)
    mftgsivaivtpmdekgnvcraslkklidyhvasgtsaivsvgttgesatlnhdehadvv
    mmtldladgripviagtganataeaisltqrfndsgivgcltvtpyynrpsqeglyqhfk
    aiaehtdlpqilynvpsrtgcdllpetvgrlakvkniigikeatgnltrvnqikelvsdd
    fvllsgddasaldfmqlgghgvisvtanvaardmaqmcklaaeghfaearvinqrlmplh
    nklfvepnpipvkwackelglvatdtlrlpmtpitdsgretvraalkhagll