PDB entry 1yxb

View 1yxb on RCSB PDB site
Description: Crystal structure of Phosphoribosyl-ATP pyrophosphatase from Streptomyces coelicolor. NESG target RR8.
Class: hydrolase
Keywords: Phosphoribosyl-ATP pyrophosphatase, Structural Genomics, PSI, Protein Structure Initiative, Northeast Structural Genomics Consortium, NESG
Deposited on 2005-02-20, released 2005-03-01
The last revision prior to the SCOP 1.73 freeze date was dated 2005-05-03, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.25
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Phosphoribosyl-ATP pyrophosphatase
    Species: Streptomyces coelicolor
    Gene: hisE
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9EWK0 (Start-89)
      • modified residue (50)
      • modified residue (74-75)
      • his tag (90)
    Domains in SCOP 1.73: d1yxba1
  • Chain 'B':
    Compound: Phosphoribosyl-ATP pyrophosphatase
    Species: Streptomyces coelicolor
    Gene: hisE
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9EWK0 (Start-89)
      • modified residue (50)
      • modified residue (74-75)
      • his tag (90)
    Domains in SCOP 1.73: d1yxbb1
  • Chain 'C':
    Compound: Phosphoribosyl-ATP pyrophosphatase
    Species: Streptomyces coelicolor
    Gene: hisE
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9EWK0 (Start-89)
      • modified residue (50)
      • modified residue (74-75)
      • his tag (90)
    Domains in SCOP 1.73: d1yxbc1
  • Chain 'D':
    Compound: Phosphoribosyl-ATP pyrophosphatase
    Species: Streptomyces coelicolor
    Gene: hisE
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9EWK0 (Start-89)
      • modified residue (50)
      • modified residue (74-75)
      • his tag (90)
    Domains in SCOP 1.73: d1yxbd1
  • Chain 'E':
    Compound: Phosphoribosyl-ATP pyrophosphatase
    Species: Streptomyces coelicolor
    Gene: hisE
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9EWK0 (Start-89)
      • modified residue (50)
      • modified residue (74-75)
      • his tag (90)
    Domains in SCOP 1.73: d1yxbe1
  • Chain 'F':
    Compound: Phosphoribosyl-ATP pyrophosphatase
    Species: Streptomyces coelicolor
    Gene: hisE
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9EWK0 (Start-89)
      • modified residue (50)
      • modified residue (74-75)
      • his tag (90)
    Domains in SCOP 1.73: d1yxbf1
  • Chain 'G':
    Compound: Phosphoribosyl-ATP pyrophosphatase
    Species: Streptomyces coelicolor
    Gene: hisE
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9EWK0 (Start-89)
      • modified residue (50)
      • modified residue (74-75)
      • his tag (90)
    Domains in SCOP 1.73: d1yxbg1
  • Chain 'H':
    Compound: Phosphoribosyl-ATP pyrophosphatase
    Species: Streptomyces coelicolor
    Gene: hisE
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9EWK0 (Start-89)
      • modified residue (50)
      • modified residue (74-75)
      • his tag (90)
    Domains in SCOP 1.73: d1yxbh1
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1yxbA (A:)
    mskktfeelftelqhkaangdpatsrtaelvdkgvhaigkkvveeaaevwmaaeyegkda
    aaeeisqllyhvqvmmvargislddvyahllehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yxbA (A:)
    ktfeelftelqhkaantsrtaelvdkgvhaigkkvveeaaevwmaaeyegkdaaaeeisq
    llyhvqvmmvargislddvyahll
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1yxbB (B:)
    mskktfeelftelqhkaangdpatsrtaelvdkgvhaigkkvveeaaevwmaaeyegkda
    aaeeisqllyhvqvmmvargislddvyahllehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yxbB (B:)
    ktfeelftelqhkaantsrtaelvdkgvhaigkkvveeaaevwmaaeyegkdaaaeeisq
    llyhvqvmmvargislddvyahll
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1yxbC (C:)
    mskktfeelftelqhkaangdpatsrtaelvdkgvhaigkkvveeaaevwmaaeyegkda
    aaeeisqllyhvqvmmvargislddvyahllehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yxbC (C:)
    ktfeelftelqhkaantsrtaelvdkgvhaigkkvveeaaevwmaaeyegkdaaaeeisq
    llyhvqvmmvargislddvyahll
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1yxbD (D:)
    mskktfeelftelqhkaangdpatsrtaelvdkgvhaigkkvveeaaevwmaaeyegkda
    aaeeisqllyhvqvmmvargislddvyahllehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yxbD (D:)
    ktfeelftelqhkaantsrtaelvdkgvhaigkkvveeaaevwmaaeyegkdaaaeeisq
    llyhvqvmmvargislddvyahll
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1yxbE (E:)
    mskktfeelftelqhkaangdpatsrtaelvdkgvhaigkkvveeaaevwmaaeyegkda
    aaeeisqllyhvqvmmvargislddvyahllehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yxbE (E:)
    ktfeelftelqhkaantsrtaelvdkgvhaigkkvveeaaevwmaaeyegkdaaaeeisq
    llyhvqvmmvargislddvyahll
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1yxbF (F:)
    mskktfeelftelqhkaangdpatsrtaelvdkgvhaigkkvveeaaevwmaaeyegkda
    aaeeisqllyhvqvmmvargislddvyahllehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yxbF (F:)
    ktfeelftelqhkaantsrtaelvdkgvhaigkkvveeaaevwmaaeyegkdaaaeeisq
    llyhvqvmmvargislddvyahll
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1yxbG (G:)
    mskktfeelftelqhkaangdpatsrtaelvdkgvhaigkkvveeaaevwmaaeyegkda
    aaeeisqllyhvqvmmvargislddvyahllehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yxbG (G:)
    ktfeelftelqhkaantsrtaelvdkgvhaigkkvveeaaevwmaaeyegkdaaaeeisq
    llyhvqvmmvargislddvyahll
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1yxbH (H:)
    mskktfeelftelqhkaangdpatsrtaelvdkgvhaigkkvveeaaevwmaaeyegkda
    aaeeisqllyhvqvmmvargislddvyahllehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yxbH (H:)
    ktfeelftelqhkaantsrtaelvdkgvhaigkkvveeaaevwmaaeyegkdaaaeeisq
    llyhvqvmmvargislddvyahll