PDB entry 1yxa

View 1yxa on RCSB PDB site
Description: serpina3n, a murine orthologue of human antichymotrypsin
Deposited on 2005-02-20, released 2005-09-06
The last revision was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: serine (or cysteine) proteinase inhibitor, clade A, member 3N
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q91WP6 (Start-397)
      • conflict (48)
      • conflict (63-64)
  • Chain 'B':
    Compound: serine (or cysteine) proteinase inhibitor, clade A, member 3N
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q91WP6 (Start-397)
      • conflict (48)
      • conflict (63-64)
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >1yxaA (A:)
    fpdgtlgmdaavqedhdngtqldsltlasintdfafslykelvlknpdtnivfsplsisa
    alalvslgakgntleeileglkfnltetseadihqgfghllqrlnqpkdqvqistgsalf
    iekrqqiltefqekaktlyqaeaftadfqqprqakklindyvrkqtqgmikelvsdldkr
    tlmvlvnyiyfkakwkvpfdpldtfksefycgkrrpvivpmmsmedlttpyfrdeelsct
    vvelkytgnasalfilpdqgrmqqveaslqpetlrkwknslkprmidelhlpkfsistdy
    sledvlsklgirevfstqadlsaitgtkdlrvsqvvhkavldvaetgteaaaatgvkfvp
    msaklypltvyfnrpflimifdteteiapfiakianpk
    

    Sequence, based on observed residues (ATOM records):
    >1yxaA (A:)
    lasintdfafslykelvlknpdtnivfsplsisaalalvslgakgntleeileglkfnlt
    etseadihqgfghllqrlnqpkdqvqistgsalfiekrqqiltefqekaktlyqaeafta
    dfqqprqakklindyvrkqtqgmikelvsdldkrtlmvlvnyiyfkakwkvpfdpldtfk
    sefycgkrrpvivpmmsmedlttpyfrdeelsctvvelkytgnasalfilpdqgrmqqve
    aslqpetlrkwknslkprmidelhlpkfsistdysledvlsklgirevfstqadlsaitg
    tkdlrvsqvvhkavldvaetgteaaaatgvkfvpmsaklypltvyfnrpflimifdtete
    iapfiakianpk
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >1yxaB (B:)
    fpdgtlgmdaavqedhdngtqldsltlasintdfafslykelvlknpdtnivfsplsisa
    alalvslgakgntleeileglkfnltetseadihqgfghllqrlnqpkdqvqistgsalf
    iekrqqiltefqekaktlyqaeaftadfqqprqakklindyvrkqtqgmikelvsdldkr
    tlmvlvnyiyfkakwkvpfdpldtfksefycgkrrpvivpmmsmedlttpyfrdeelsct
    vvelkytgnasalfilpdqgrmqqveaslqpetlrkwknslkprmidelhlpkfsistdy
    sledvlsklgirevfstqadlsaitgtkdlrvsqvvhkavldvaetgteaaaatgvkfvp
    msaklypltvyfnrpflimifdteteiapfiakianpk
    

    Sequence, based on observed residues (ATOM records):
    >1yxaB (B:)
    ldsltlasintdfafslykelvlknpdtnivfsplsisaalalvslgakgntleeilegl
    kfnltetseadihqgfghllqrldqvqistgsalfiekrqqiltefqekaktlyqaeaft
    adfqqprqakklindyvrkqtqgmikelvsdldkrtlmvlvnyiyfkakwkvpfdpldtf
    ksefycgkrrpvivpmmsmedlttpyfrdeelsctvvelkytgnasalfilpdqgrmqqv
    easlqpetlrkwknslkprmidelhlpkfsistdysledvlsklgirevfstqadlsait
    gtkdlrvsqvvhkavldvaetgteaaaatgvkfklypltvyfnrpflimifdteteiapf
    iakianpk