PDB entry 1yx7

View 1yx7 on RCSB PDB site
Description: NMR structure of Calsensin, energy minimized average structure.
Class: metal binding protein
Keywords: Calsensin, calcium-binding protein EF-hand, helix-loop-helix, nervous system, METAL BINDING PROTEIN
Deposited on 2005-02-19, released 2005-04-01
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Calsensin
    Species: Haemopis marmorata [TaxId:38567]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1yx7a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1yx7A (A:)
    mackvkaeleaafkkldangdgyvtalelqtfmvtldaykalskdkvkeasaklikmadk
    nsdgkiskeeflnanaellcqlk