PDB entry 1yx4

View 1yx4 on RCSB PDB site
Description: Structure of S5a bound to monoubiquitin provides a model for polyubiquitin recognition
Deposited on 2005-02-19, released 2005-04-19
The last revision was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 26S proteasome non-ATPase regulatory subunit 4
    Species: Homo sapiens [TaxId:9606]
    Gene: PSMD4, MCB1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P55036 (Start-131)
      • cloning artifact (20)

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >1yx4A (A:)
    mghhhhhhhhhhssghiegrhmlglgasdfefgvdpsadpelalalrvsmeeqrqrqeee
    arraaaasaaeagiattgtedsddallkmtisqqefgrtglpdlssmteeeqiayamqms
    lqgaefgqaesa
    

    Sequence, based on observed residues (ATOM records):
    >1yx4A (A:)
    hmlglgasdfefgvdpsadpelalalrvsmeeqrqrqeeearraaaasaaeagiattgte
    dsddallkmtisqqefgrtglpdlssmteeeqiayamqmslqgaefgqaesa