PDB entry 1yx3

View 1yx3 on RCSB PDB site
Description: NMR structure of Allochromatium vinosum DsrC: Northeast Structural Genomics Consortium target OP4
Class: structural genomics, unknown function
Keywords: structural genomics, DsrC, Dissimilatory sulfite reductase, gamma subunit, DsvC, PSI, Protein Structure Initiative, Northeast Structural Genomics Consortium, NESG, UNKNOWN FUNCTION
Deposited on 2005-02-19, released 2005-04-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hypothetical protein DsrC
    Species: Allochromatium vinosum [TaxId:1049]
    Gene: DsrC
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1yx3a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1yx3A (A:)
    mgsshhhhhhssglvprgshmadtievdgkqfavdeegylsnlndwvpgvadvmakqdnl
    elteehwdiinflreyyeeyqiapavrvltkavgkklgkekgnskylyslfpygpakqac
    rfaglpkptgcv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yx3A (A:)
    madtievdgkqfavdeegylsnlndwvpgvadvmakqdnlelteehwdiinflreyyeey
    qiapavrvltkavgkklgkekgnskylyslfpygpakqacrfaglpkptgcv