PDB entry 1yx2

View 1yx2 on RCSB PDB site
Description: Crystal Structure of the Probable Aminomethyltransferase from Bacillus subtilis
Class: transferase
Keywords: aminomethyltransferase, glycine cleavage system T protein, alpha-beta, beta-barrel, Structural Genomics, PSI, Protein Structure Initiative, Midwest Center for Structural Genomics, MCSG
Deposited on 2005-02-19, released 2005-04-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.08 Å
R-factor: 0.219
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Aminomethyltransferase
    Species: Bacillus subtilis [TaxId:1423]
    Gene: gcvT
    Database cross-references and differences (RAF-indexed):
    • Uniprot P54378
      • modified residue (54)
      • modified residue (72)
      • modified residue (89)
      • modified residue (126)
      • modified residue (207)
      • conflict (239)
      • modified residue (292)
    Domains in SCOPe 2.07: d1yx2a1, d1yx2a2
  • Chain 'B':
    Compound: Aminomethyltransferase
    Species: Bacillus subtilis [TaxId:1423]
    Gene: gcvT
    Database cross-references and differences (RAF-indexed):
    • Uniprot P54378 (3-364)
      • modified residue (3)
      • modified residue (54)
      • modified residue (72)
      • modified residue (89)
      • modified residue (126)
      • modified residue (207)
      • conflict (239)
      • modified residue (292)
    Domains in SCOPe 2.07: d1yx2b1, d1yx2b2
  • Heterogens: EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1yx2A (A:)
    snamlkrtplfdlykeyggktidfggwelpvqfssikkeheavrtaaglfdvshmgevev
    sgndslsflqrlmtndvsaltpgraqytamcypdggtvddlliyqkgenryllvinasni
    dkdlawmkehaagdvqidnqsdqiallavqgpkaeailknltdadvsalkpfafideadi
    sgrkalisrtgytgedgyeiycrsddamhiwkkiidagdayglipcglgardtlrfeani
    plygqeltrditpieagigfavkhkkesdffgksvlseqkengakrklvglemiekgipr
    hgyevfqngksvgkvttgtqsptlgknvglalidsetseigtvvdveirkklvkakvvkt
    pfykr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yx2A (A:)
    lkrtplfdlykeyggktidfggwelpvqfssikkeheavrtaaglfdvshmgevevsgnd
    slsflqrlmtndvsaltpgraqytamcypdggtvddlliyqkgenryllvinasnidkdl
    awmkehaagdvqidnqsdqiallavqgpkaeailknltdadvsalkpfafideadisgrk
    alisrtgytgedgyeiycrsddamhiwkkiidagdayglipcglgardtlrfeaniplyg
    qeltrditpieagigfavkhkkesdffgksvlseqkengakrklvglemiekgiprhgye
    vfqngksvgkvttgtqsptlgknvglalidsetseigtvvdveirkklvkakvvktpf
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1yx2B (B:)
    snamlkrtplfdlykeyggktidfggwelpvqfssikkeheavrtaaglfdvshmgevev
    sgndslsflqrlmtndvsaltpgraqytamcypdggtvddlliyqkgenryllvinasni
    dkdlawmkehaagdvqidnqsdqiallavqgpkaeailknltdadvsalkpfafideadi
    sgrkalisrtgytgedgyeiycrsddamhiwkkiidagdayglipcglgardtlrfeani
    plygqeltrditpieagigfavkhkkesdffgksvlseqkengakrklvglemiekgipr
    hgyevfqngksvgkvttgtqsptlgknvglalidsetseigtvvdveirkklvkakvvkt
    pfykr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yx2B (B:)
    mlkrtplfdlykeyggktidfggwelpvqfssikkeheavrtaaglfdvshmgevevsgn
    dslsflqrlmtndvsaltpgraqytamcypdggtvddlliyqkgenryllvinasnidkd
    lawmkehaagdvqidnqsdqiallavqgpkaeailknltdadvsalkpfafideadisgr
    kalisrtgytgedgyeiycrsddamhiwkkiidagdayglipcglgardtlrfeaniply
    gqeltrditpieagigfavkhkkesdffgksvlseqkengakrklvglemiekgiprhgy
    evfqngksvgkvttgtqsptlgknvglalidsetseigtvvdveirkklvkakvvktpfy
    kr