PDB entry 1yx1

View 1yx1 on RCSB PDB site
Description: Crystal Structure of Protein of Unknown Function PA2260 from Pseudomonas aeruginosa, Possible Sugar Phosphate Isomerase
Class: structural genomics, unknown function
Keywords: structural genomics, hypothetical protein, PA2260, PSI, Protein Structure Initiative, Midwest Center for Structural Genomics, MCSG
Deposited on 2005-02-19, released 2005-04-05
The last revision prior to the SCOP 1.73 freeze date was dated 2006-04-11, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.169
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hypothetical protein PA2260
    Species: Pseudomonas aeruginosa
    Gene: PA2260
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9I1L3
      • modified residue (33)
      • modified residue (159)
    Domains in SCOP 1.73: d1yx1a1
  • Chain 'B':
    Compound: hypothetical protein PA2260
    Species: Pseudomonas aeruginosa
    Gene: PA2260
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9I1L3
      • modified residue (33)
      • modified residue (159)
    Domains in SCOP 1.73: d1yx1b1
  • Chain 'C':
    Compound: hypothetical protein PA2260
    Species: Pseudomonas aeruginosa
    Gene: PA2260
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9I1L3
      • modified residue (33)
      • modified residue (159)
    Domains in SCOP 1.73: d1yx1c1
  • Heterogens: NA, IPA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1yx1A (A:)
    ghmslhpvsislssygadlvrsrgqasflpllamagaqrvelreelfagppdtealtaai
    qlqglecvfssplelwredgqlnpeleptlrraeacgagwlkvslgllpeqpdlaalgrr
    larhglqllvendqtpqggrievlerffrlaerqqldlamtfdignwrwqeqaadeaalr
    lgryvgyvhckavirnrdgklvavppsaadlqywqrllqhfpegvaraieyplqgddlls
    lsrrhiaalarlgqpqeerqhggs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yx1A (A:)
    lhpvsislssygadlvrsrgqasflpllamagaqrvelreelfagppdtealtaaiqlqg
    lecvfssplelwredgqlnpeleptlrraeacgagwlkvslgllpeqpdlaalgrrlarh
    glqllvendqtpqggrievlerffrlaerqqldlamtfdignwrwqeqaadeaalrlgry
    vgyvhckavirnrdgklvavppsaadlqywqrllqhfpegvaraieyplqgddllslsrr
    hiaalarlgq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1yx1B (B:)
    ghmslhpvsislssygadlvrsrgqasflpllamagaqrvelreelfagppdtealtaai
    qlqglecvfssplelwredgqlnpeleptlrraeacgagwlkvslgllpeqpdlaalgrr
    larhglqllvendqtpqggrievlerffrlaerqqldlamtfdignwrwqeqaadeaalr
    lgryvgyvhckavirnrdgklvavppsaadlqywqrllqhfpegvaraieyplqgddlls
    lsrrhiaalarlgqpqeerqhggs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yx1B (B:)
    lhpvsislssygadlvrsrgqasflpllamagaqrvelreelfagppdtealtaaiqlqg
    lecvfssplelwredgqlnpeleptlrraeacgagwlkvslgllpeqpdlaalgrrlarh
    glqllvendqtpqggrievlerffrlaerqqldlamtfdignwrwqeqaadeaalrlgry
    vgyvhckavirnrdgklvavppsaadlqywqrllqhfpegvaraieyplqgddllslsrr
    hiaalarlgqp
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1yx1C (C:)
    ghmslhpvsislssygadlvrsrgqasflpllamagaqrvelreelfagppdtealtaai
    qlqglecvfssplelwredgqlnpeleptlrraeacgagwlkvslgllpeqpdlaalgrr
    larhglqllvendqtpqggrievlerffrlaerqqldlamtfdignwrwqeqaadeaalr
    lgryvgyvhckavirnrdgklvavppsaadlqywqrllqhfpegvaraieyplqgddlls
    lsrrhiaalarlgqpqeerqhggs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yx1C (C:)
    lhpvsislssygadlvrsrgqasflpllamagaqrvelreelfagppdtealtaaiqlqg
    lecvfssplelwredgqlnpeleptlrraeacgagwlkvslgllpeqpdlaalgrrlarh
    glqllvendqtpqggrievlerffrlaerqqldlamtfdignwrwqeqaadeaalrlgry
    vgyvhckavirnrdgklvavppsaadlqywqrllqhfpegvaraieyplqgddllslsrr
    hiaalarlgq