PDB entry 1yx0

View 1yx0 on RCSB PDB site
Description: Solution Structure of Bacillus subtilis Protein ysnE: The Northeast Structural Genomics Consortium Target SR220
Class: structural genomics, unknown function
Keywords: NESG, GFT NMR, Structral Genomics, SR220, Structural Genomics, PSI, Protein Structure Initiative, Northeast Structural Genomics Consortium, UNKNOWN FUNCTION
Deposited on 2005-02-18, released 2005-03-29
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hypothetical protein ysnE
    Species: Bacillus subtilis subsp. subtilis str. 168 [TaxId:224308]
    Gene: ysnE
    Database cross-references and differences (RAF-indexed):
    • GB NP_390711 (0-150)
    Domains in SCOPe 2.03: d1yx0a1

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1yx0A (A:)
    mhikiddltgrqvvslvnehlhsmtlmsppesihalgleklrgpeitfwsawegdelagc
    galkeldtrhgeiksmrtsashlrkgvakqvlqhiieeaekrgyerlsletgsmasfepa
    rklyesfgfqycepfadygedpnsvfmtkkllehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yx0A (A:)
    mhikiddltgrqvvslvnehlhsmtlmsppesihalgleklrgpeitfwsawegdelagc
    galkeldtrhgeiksmrtsashlrkgvakqvlqhiieeaekrgyerlsletgsmasfepa
    rklyesfgfqycepfadygedpnsvfmtkkl