PDB entry 1ywz

View 1ywz on RCSB PDB site
Description: Solution Structure of Human Ubiquitin-fold Modifier-Conjugating Enzyme 1(UFC1): The Northeast Structural Genomics Consortium Target HR41
Class: structural genomics, unknown function
Keywords: NESG, GFT NMR, Structral Genomics, HR41, Structural Genomics, PSI, Protein Structure Initiative, Northeast Structural Genomics Consortium
Deposited on 2005-02-18, released 2005-03-29
The last revision prior to the SCOPe 2.08 freeze date was dated 2008-02-19, with a file datestamp of 2008-02-15.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protein CGI-126
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1ywza_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ywzA (A:)
    madeatrrvvseipvlktnagprdrelwvqrlkeeyqsliryvennknadndwfrlesnk
    egtrwfgkcwyihdllkyefdiefdipitypttapeiavpeldgktakmyrggkicltdh
    fkplwarnvpkfglahlmalglgpwlaveipdliqkgviqhkekcnqlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ywzA (A:)
    madeatrrvvseipvlktnagprdrelwvqrlkeeyqsliryvennknadndwfrlesnk
    egtrwfgkcwyihdllkyefdiefdipitypttapeiavpeldgktakmyrggkicltdh
    fkplwarnvpkfglahlmalglgpwlaveipdliqkgviqhkekcnq