PDB entry 1ywy

View 1ywy on RCSB PDB site
Description: Solution Structure of Pseudomonas aeruginosa Protein PA2021. The Northeast Structural Genomics Consortium Target Pat85.
Class: structural genomics, unknown function
Keywords: Pat85, NESG, GFT-NMR, Structural Genomics, PSI, Protein Structure Initiative, Northeast Structural Genomics Consortium, UNKNOWN FUNCTION
Deposited on 2005-02-18, released 2005-04-12
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hypothetical protein PA2021
    Species: PSEUDOMONAS AERUGINOSA [TaxId:208964]
    Database cross-references and differences (RAF-indexed):
    • GB AAG05409 (0-73)
    Domains in SCOPe 2.08: d1ywya1

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1ywyA (A:)
msieidseqgvcsveiegsrhrapvdslrigtdaearlsvlyidgkrlhiseedaqrlvv
agaedqrrhlmadd