PDB entry 1ywx

View 1ywx on RCSB PDB site
Description: Solution Structure of Methanococcus maripaludis Protein MMP0443: The Northeast Structural Genomics Consortium Target MrR16
Class: structural genomics, unknown function
Keywords: GFT NMR, MrR16, NESGC, Structural Genomics, PSI, Protein Structure Initiative, Northeast Structural Genomics Consortium, UNKNOWN FUNCTION
Deposited on 2005-02-18, released 2005-04-05
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 30S ribosomal protein S24e
    Species: Methanococcus maripaludis [TaxId:39152]
    Gene: rps24e
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1ywxa1

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1ywxA (A:)
mdisiisdrnnpllqrreikftvsfdaatpsikdvkmklvavlnankqvlvvdtldqifg
kleaegyakiyndekamatietksvleknkieeeaeaevaee