PDB entry 1ywx

View 1ywx on RCSB PDB site
Description: Solution Structure of Methanococcus maripaludis Protein MMP0443: The Northeast Structural Genomics Consortium Target MrR16
Class: structural genomics, unknown function
Keywords: GFT NMR, MrR16, NESGC, Structural Genomics, PSI, Protein Structure Initiative, Northeast Structural Genomics Consortium
Deposited on 2005-02-18, released 2005-04-05
The last revision prior to the SCOP 1.75 freeze date was dated 2006-04-18, with a file datestamp of 2007-06-04.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: 30S ribosomal protein S24e
  Species: Methanococcus maripaludis
  Gene: rps24e
  Database cross-references and differences (RAF-indexed):
  • Uniprot P61193 (0-101)
  Domains in SCOP 1.75: d1ywxa1

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1ywxA (A:)
  mdisiisdrnnpllqrreikftvsfdaatpsikdvkmklvavlnankqvlvvdtldqifg
  kleaegyakiyndekamatietksvleknkieeeaeaevaee