PDB entry 1yww

View 1yww on RCSB PDB site
Description: NMR structure of P. aeruginosa protein PA4738: Northeast Structural Genomics Consortium target PaP2
Class: structural genomics, unknown function
Keywords: structural genomics, YjbJ, PSI, Protein Structure Initiative, Northeast Structural Genomics Consortium, NESG, UNKNOWN FUNCTION
Deposited on 2005-02-18, released 2005-03-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hypothetical protein PA4738
    Species: Pseudomonas aeruginosa [TaxId:287]
    Gene: PA4738
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ywwa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ywwA (A:)
    mgsshhhhhhssglvprgshmnsdvikgkwkqltgkikerwgdltdddlqaadghaeylv
    gklqerygwskeraeqevrdfsdrl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ywwA (A:)
    mnsdvikgkwkqltgkikerwgdltdddlqaadghaeylvgklqerygwskeraeqevrd
    fsdrl