PDB entry 1ywv

View 1ywv on RCSB PDB site
Description: Crystal Structures of Proto-Oncogene Kinase Pim1: a Target of Aberrant Somatic Hypermutations in Diffuse Large Cell Lymphoma
Class: transferase
Keywords: Ser/Thr protein kinase, TRANSFERASE
Deposited on 2005-02-18, released 2005-04-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-06-24, with a file datestamp of 2015-06-19.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Proto-oncogene serine/threonine-protein kinase Pim-1
    Species: Homo sapiens [TaxId:9606]
    Gene: PIM1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ywva_
  • Heterogens: IMD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ywvA (A:)
    kekeplesqyqvgpllgsggfgsvysgirvsdnlpvaikhvekdrisdwgelpngtrvpm
    evvllkkvssgfsgvirlldwferpdsfvlilerpepvqdlfdfitergalqeelarsff
    wqvleavrhchncgvlhrdikdenilidlnrgelklidfgsgallkdtvytdfdgtrvys
    ppewiryhryhgrsaavwslgillydmvcgdipfehdeeiirgqvffrqrvssecqhlir
    wclalrpsdrptfeeiqnhpwmqdvllpqetaeihlhslspgpskvdhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ywvA (A:)
    plesqyqvgpllgsggfgsvysgirvsdnlpvaikhvekdrisdwgelpngtrvpmevvl
    lkkvssgfsgvirlldwferpdsfvlilerpepvqdlfdfitergalqeelarsffwqvl
    eavrhchncgvlhrdikdenilidlnrgelklidfgsgallkdtvytdfdgtrvysppew
    iryhryhgrsaavwslgillydmvcgdipfehdeeiirgqvffrqrvssecqhlirwcla
    lrpsdrptfeeiqnhpwmqdvllpqetaeihlhs